Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.04
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 6.82546201746224E-79
lung carcinoma 2844 4.63447424048501E-18
posterior fossa group A ependymoma 1511 1.37983981102877E-16
Breast cancer 3099 1.23241950997264E-15
oligodendroglioma 2849 1.0017633920509E-12
atypical teratoid / rhabdoid tumor 4369 3.14882015438544E-8
pilocytic astrocytoma 3086 5.87699085253731E-7
sonic hedgehog group medulloblastoma 1482 1.22988766397773E-6
glioblastoma 5572 2.56573102286807E-5
pediatric high grade glioma 2712 4.34282092541658E-5
medulloblastoma, large-cell 6234 2.87805385036092E-4
lung cancer 4473 0.00325161629734781
primitive neuroectodermal tumor 3031 0.00343796063504552
ovarian cancer 8492 0.00705247357252075
astrocytoma 1493 0.00923905918644656
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0192887221461477
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0315734169959085
subependymal giant cell astrocytoma 2287 0.0403601053416472
Disease Target Count Z-score Confidence
Liver Cirrhosis 101 0.0 1.0
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 156 4.171 2.1

Expression

Synonym

Accession Q96HU8 B3KVM2
Symbols Di-Ras2

Gene

PDB

2ERX  

  Ortholog (11)

Gene RIF (2)

PMID Text
21750579 Four single nucleotide polymorphisms (SNPs) and two haplotype blocks in DIRAS2 show evidence of association with attention deficit/hyperactivity disorder (ADHD) in adults.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPA      1 - 70
MQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALA     71 - 140
RTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM               141 - 199
//

Text Mined References (10)

PMID Year Title
21750579 2011 DIRAS2 is associated with adult ADHD, related traits, and co-morbid disorders.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194967 2002 Di-Ras, a distinct subgroup of ras family GTPases with unique biochemical properties.