Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.57
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.200 7.9e-04
astrocytic glioma -2.500 2.5e-03
Astrocytoma, Pilocytic -3.300 7.4e-07
atypical teratoid / rhabdoid tumor -6.100 3.1e-08
Breast cancer -1.500 1.2e-15
ependymoma -3.800 5.8e-03
glioblastoma -3.200 1.2e-06
group 4 medulloblastoma -2.100 1.3e-02
intraductal papillary-mucinous adenoma (... -1.400 1.9e-02
intraductal papillary-mucinous carcinoma... -1.400 3.2e-02
lung cancer 1.800 3.3e-03
lung carcinoma 1.700 4.6e-18
medulloblastoma, large-cell -4.800 2.9e-04
oligodendroglioma -2.200 4.1e-02
ovarian cancer 1.700 7.1e-03
primitive neuroectodermal tumor -3.700 3.4e-03
psoriasis -2.800 6.8e-79
subependymal giant cell astrocytoma -2.323 4.0e-02

Gene RIF (3)

AA Sequence

MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPA      1 - 70
MQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALA     71 - 140
RTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM               141 - 199
//

Text Mined References (11)

PMID Year Title