Property Summary

NCBI Gene PubMed Count 15
Grant Count 6
R01 Count 5
Funding $217,673.56
PubMed Score 16.59
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

Gene RIF (9)

PMID Text
26381214 Results identify a crucial role for RIPK3-PGAM5-Drp1/NFAT signalling in NKT cell activation, and further suggest that RIPK3-PGAM5 signalling may mediate crosstalk between mitochondrial function and immune signalling.
26356820 Results indicate that a multiprotein complex including PGAM5, Bax and Drp1 proteins specifically formed during intrinsic apoptosis induction.
25126723 The BCL2L1-PGAM5-FUNDC1 axis is critical for receptor-mediated mitophagy.
24746696 Dephosphorylation of FUNDC1 by PGAM5 induces mitophagy.
23201124 PGAM5 is proteolytically processed, accumulates in the cytosol during apoptosis, and sensitizes cells to death.
22915595 Rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5.
22265414 Experimental data indicate that the two splice variants of the mitochondrial protein phosphatase PGAM5 are at the convergent point of multiple necrosis pathways.
19590015 Results suggest that this member of the PGAM family has crossed over from small molecules to protein substrates and been adapted to serve as a specialized activator of ASK1.
17046835 The N terminus of the PGAM5 protein contains a conserved NXESGE motif that binds to the substrate binding pocket in the Kelch domain of Keap1.

AA Sequence

MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSL      1 - 70
INVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGL     71 - 140
KFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRN    141 - 210
YIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGF    211 - 280
MPPDKITRS                                                                 281 - 289
//

Text Mined References (23)

PMID Year Title
26381214 2015 Regulation of NKT cell-mediated immune responses to tumours and liver inflammation by mitochondrial PGAM5-Drp1 signalling.
26356820 2015 Bax-PGAM5L-Drp1 complex is required for intrinsic apoptosis execution.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25126723 2014 The BCL2L1 and PGAM5 axis defines hypoxia-induced receptor-mediated mitophagy.
24746696 2014 A regulatory signaling loop comprising the PGAM5 phosphatase and CK2 controls receptor-mediated mitophagy.
23201124 2013 Substrates of IAP ubiquitin ligases identified with a designed orthogonal E3 ligase, the NEDDylator.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22915595 2012 Rhomboid protease PARL mediates the mitochondrial membrane potential loss-induced cleavage of PGAM5.
22265414 2012 The mitochondrial phosphatase PGAM5 functions at the convergence point of multiple necrotic death pathways.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...