Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.54
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

AA Sequence

MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSL      1 - 70
INVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGL     71 - 140
KFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRN    141 - 210
YIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGF    211 - 280
MPPDKITRS                                                                 281 - 289
//

Text Mined References (24)

PMID Year Title