Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.37
PubTator Score 6.73

Knowledge Summary


No data available


  Disease Sources (4)


  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.729 0.000
group 3 medulloblastoma 1.900 0.000
primitive neuroectodermal tumor 1.100 0.037
ovarian cancer 1.500 0.001
Breast cancer 1.300 0.001


Accession Q96HR3 C6GKU9
Symbols MED30S


  Ortholog (9)

 GWAS Trait (1)

Gene RIF (4)

25100719 SiRNA knockdown of d MED30 shows a modest inhibition in HIV-1 Tat-mediated transcription levels as compared to control
25100719 Knockdown of mediator complex subunit 30 (MED30) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
20493979 analysis of a novel transcript of MED30, termed MED30 short (MED30s) generated by alternative splicing
11909976 Requirement of TRAP/mediator for both activator-independent and activator-dependent transcription in conjunction with TFIID-associated TAF(II)s.

AA Sequence

EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN                                    141 - 178

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22446961 2012 Two new susceptibility loci for Kawasaki disease identified through genome-wide association analysis.
21784977 2011 Zinc finger protein tristetraprolin interacts with CCL3 mRNA and regulates tissue inflammation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20493979 2010 Mediator subunits: gene expression pattern, a novel transcript identification and nuclear localization in human endothelial progenitor cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.