Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.62
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 1.300 5.4e-04
group 3 medulloblastoma 1.300 3.2e-03
osteosarcoma 1.729 3.5e-04
ovarian cancer 1.500 1.3e-03
primitive neuroectodermal tumor 1.100 3.7e-02

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGT      1 - 70
YQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERR     71 - 140
EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN                                    141 - 178
//

Text Mined References (27)

PMID Year Title