Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.14
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.28974355696838E-18
ovarian cancer 8492 5.9451341775047E-9
osteosarcoma 7933 8.35301495646771E-5
astrocytic glioma 2241 0.0387724833775166

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.700 0.039
osteosarcoma -1.149 0.000
lung carcinoma 1.100 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q96HQ2 Q8WVE3
Symbols

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMV      1 - 70
WANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS                             71 - 116
//

Text Mined References (4)

PMID Year Title
26779609 2016 Structural basis and function of XRN2 binding by XTB domains.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.