Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.14
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.700 0.039
osteosarcoma -1.149 0.000
lung carcinoma 1.100 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q96HQ2 Q8WVE3
Symbols

Gene

AA Sequence

MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMV      1 - 70
WANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS                             71 - 116
//

Text Mined References (4)

PMID Year Title
26779609 2016 Structural basis and function of XRN2 binding by XTB domains.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.