Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.14
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 4.3e-18
ovarian cancer 8520 5.9e-09
osteosarcoma 7950 8.4e-05
astrocytic glioma 2597 3.9e-02

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.700 3.9e-02
lung carcinoma 1.100 4.3e-18
osteosarcoma -1.149 8.4e-05
ovarian cancer 1.100 5.9e-09

AA Sequence

MVGGEAAAAVEELVSGVRQAADFAEQFRSYSESEKQWKARMEFILRHLPDYRDPPDGSGRLDQLLSLSMV      1 - 70
WANHLFLGCSYNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS                             71 - 116
//

Text Mined References (5)

PMID Year Title