Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.14
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 3.4e-06
tuberculosis 2010 4.7e-04
osteosarcoma 7950 1.0e-03
lung cancer 4740 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cystadenoma 6 3.858 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.400 1.1e-03
malignant mesothelioma -1.400 3.4e-06
osteosarcoma -1.064 1.0e-03
tuberculosis -1.100 4.7e-04

Gene RIF (2)

AA Sequence

MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLLYRNVMLENFTLLASLGLAS      1 - 70
SKTHEITQLESWEEPFMPAWEVVTSAIPRGCWHGAEAEEAPEQIASVGLLSSNIQQHQKQHCGEKPLKRQ     71 - 140
EGRVPVLRSCKVHLSEKSLQSREVGKALLISSGVLKHQVTHTGEKSHRSSKSREAFHAGKRHYKCSECGK    141 - 210
AFGQKYLLVQHQRLHAGKKTYECSECGKLFRDMSNLFIHQIVHTGERPYGCSNCGKSFSRNAHLIEHQRV    211 - 280
HTGEKPFTCSECGKAFRHNSTLVQHHKIHTGVRPYECSECGKLFSFNSSLMKHQRIHTGERPYKCSECGK    281 - 350
FYSHKSNLIKHWRVHTGERPYKCSDCGKFFTQCSSLMQHQKVHTGEKPFKCNECGRFFRENSTLVRHQRV    351 - 420
HTGAKPYECRECGKFFSQSSTLMQHRKVHIGEKPFKCNECGRLFRENSSLVKHQRVHTGAKPYECRECGK    421 - 490
FFRHNSSLFKHRRIHTGEMQ                                                      491 - 510
//

Text Mined References (12)

PMID Year Title