Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.74
PubTator Score 2.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis -1.556 0.004
esophageal adenocarcinoma 1.500 0.019
glioblastoma 1.700 0.001
pancreatic ductal adenocarcinoma liver m... -2.361 0.001
lung cancer -1.500 0.001
interstitial cystitis 1.400 0.039
adult high grade glioma 1.700 0.001
pilocytic astrocytoma 2.200 0.000
sarcoidosis 1.100 0.028
subependymal giant cell astrocytoma 1.100 0.047
lung carcinoma 2.600 0.000
ovarian cancer -2.900 0.000
pituitary cancer -1.100 0.017
pancreatic cancer 1.200 0.009

Gene RIF (1)

PMID Text
22244448 human TMEM176A and 176B protein levels are significantly elevated in lymphoma, but not in normal tissues

AA Sequence

MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQARGSSRLLVASWVMQIVLGILSAV      1 - 70
LGGFFYIRDYTLLVTSGAAIWTGAVAVLAGAAAFIYEKRGGTYWALLRTLLTLAAFSTAIAALKLWNEDF     71 - 140
RYGYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLLLASLTPL    141 - 210
WLYCWRMFPTKGKRDQKEMLEVSGI                                                 211 - 235
//

Text Mined References (12)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22244448 2012 Abnormal accumulation of human transmembrane (TMEM)-176A and 176B proteins is associated with cancer pathology.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
More...