Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.34
PubTator Score 2.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.700 1.2e-03
Astrocytoma, Pilocytic 2.200 6.1e-08
esophageal adenocarcinoma 1.500 1.9e-02
glioblastoma 1.100 1.4e-03
interstitial cystitis 1.400 3.9e-02
lung cancer -1.500 6.1e-04
lung carcinoma 2.600 7.8e-22
nephrosclerosis -1.556 4.2e-03
ovarian cancer -2.900 3.6e-12
pancreatic cancer 1.200 9.3e-03
pancreatic ductal adenocarcinoma liver m... -2.361 9.4e-04
pituitary cancer -1.100 1.7e-02
sarcoidosis 1.100 2.8e-02
subependymal giant cell astrocytoma 1.100 4.7e-02

Gene RIF (3)

AA Sequence

MGTADSDEMAPEAPQHTHIDVHIHQESALAKLLLTCCSALRPRATQARGSSRLLVASWVMQIVLGILSAV      1 - 70
LGGFFYIRDYTLLVTSGAAIWTGAVAVLAGAAAFIYEKRGGTYWALLRTLLTLAAFSTAIAALKLWNEDF     71 - 140
RYGYSYYNSACRISSSSDWNTPAPTQSPEEVRRLHLCTSFMDMLKALFRTLQAMLLGVWILLLLASLTPL    141 - 210
WLYCWRMFPTKGKRDQKEMLEVSGI                                                 211 - 235
//

Text Mined References (14)

PMID Year Title