Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.83
PubTator Score 1.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96HN2 B4DIZ5 D9N155 O94917 AdoHcyase 3
Symbols IRBIT2
ADOHCYASE3

Gene

PANTHER Protein Class (1)

PDB

3GVP  

Gene RIF (1)

PMID Text
16865262 Downregulation of KIAA0828 is associated with colon and lung carcinomas

AA Sequence

MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPA      1 - 70
AALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKIG     71 - 140
RRSLSRSISQSSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPA    141 - 210
LMALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFA    211 - 280
WKGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAG    281 - 350
KLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV    351 - 420
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASL    421 - 490
RTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQ    491 - 560
DVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY                       561 - 611
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22890011 2012 Genome-wide association study indicates variants associated with insulin signaling and inflammation mediate lipoprotein responses to fenofibrate.
22228203 2012 A genome-wide association study of inflammatory biomarker changes in response to fenofibrate treatment in the Genetics of Lipid Lowering Drug and Diet Network.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
20694014 2010 Genome-wide association analyses identifies a susceptibility locus for tuberculosis on chromosome 18q11.2.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19220705 2009 An IRBIT homologue lacks binding activity to inositol 1,4,5-trisphosphate receptor due to the unique N-terminal appendage.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16865262 2006 New p53 related genes in human tumors: significant downregulation in colon and lung carcinomas.
More...