Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.67
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 3.9e-04
Common variable immunodeficiency -1.196 2.0e-02
glioblastoma -1.300 1.1e-03
head and neck cancer -1.200 7.9e-05
interstitial cystitis -2.100 3.1e-03
lung cancer -1.700 4.0e-03
medulloblastoma, large-cell -1.700 2.5e-04
Multiple myeloma 1.754 4.7e-03
ovarian cancer 1.500 1.2e-02
pancreatic ductal adenocarcinoma liver m... 2.268 2.1e-02
Pick disease -1.400 4.6e-06
progressive supranuclear palsy -1.400 7.2e-03
psoriasis 1.400 2.4e-04
ulcerative colitis -1.300 9.6e-05

Gene RIF (3)

AA Sequence

MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVVA      1 - 70
RLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGN     71 - 140
VALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSF    141 - 210
TEKYENEGQRINARKAAREQRKSSAKELPPKPLSRPQQSSAPVQLNSGSQSNRNEYKLYPGLSSYHERVG    211 - 280
NLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMN            281 - 342
//

Text Mined References (16)

PMID Year Title