Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.47
PubTator Score 3.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 4.59251930460441E-6
interstitial cystitis 2299 2.16495772019589E-5
head and neck cancer 270 7.90188656636115E-5
ulcerative colitis 2087 9.64374221765408E-5
psoriasis 6685 2.3948789947403E-4
medulloblastoma, large-cell 6234 2.53054872368441E-4
atypical teratoid / rhabdoid tumor 4369 3.90917210494013E-4
glioblastoma 5572 0.00111307515515775
lung cancer 4473 0.0040459291790633
Multiple myeloma 1328 0.00471276085721319
progressive supranuclear palsy 674 0.00715309467967721
ovarian cancer 8492 0.0120661970782163
Common variable immunodeficiency 98 0.0198876126154138
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0207106703562699

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.754 0.005
psoriasis 1.400 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.300 0.001
medulloblastoma, large-cell -1.700 0.000
pancreatic ductal adenocarcinoma liver m... 2.268 0.021
Common variable immunodeficiency -1.196 0.020
lung cancer -1.700 0.004
interstitial cystitis -2.500 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.400 0.007
ulcerative colitis -1.300 0.000
ovarian cancer 1.500 0.012
head and neck cancer -1.200 0.000

Gene RIF (3)

PMID Text
26305679 a novel AR-interacting protein, Src homology 3 (SH3)-domain containing, Ysc84-like 1 (SH3YL1), whose interaction with the receptor is dependent upon this polyproline domain, was identified.
24508479 SH3YL1 promotes Dock4-mediated cell migration and promotes Dock4-mediated Rac1 activation.
21624956 results provide new insight into the SH3YL1 molecular mechanism of dorsal ruffle formation and its regulation by phosphoinositide metabolism

AA Sequence

MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVVA      1 - 70
RLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGN     71 - 140
VALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSF    141 - 210
TEKYENEGQRINARKAAREQRKSSAKELPPKPLSRPQQSSAPVQLNSGSQSNRNEYKLYPGLSSYHERVG    211 - 280
NLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMN            281 - 342
//

Text Mined References (16)

PMID Year Title
26305679 2015 Identification of a Novel Coregulator, SH3YL1, That Interacts With the Androgen Receptor N-Terminus.
25416956 2014 A proteome-scale map of the human interactome network.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24508479 2014 Dock4 forms a complex with SH3YL1 and regulates cancer cell migration.
21624956 2011 SH3YL1 regulates dorsal ruffle formation by a novel phosphoinositide-binding domain.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...