Property Summary

NCBI Gene PubMed Count 13
Grant Count 3
Funding $95,799
PubMed Score 3.47
PubTator Score 3.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.754 0.005
psoriasis 1.400 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.300 0.001
medulloblastoma, large-cell -1.700 0.000
pancreatic ductal adenocarcinoma liver m... 2.268 0.021
Common variable immunodeficiency -1.196 0.020
lung cancer -1.700 0.004
interstitial cystitis -2.500 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.400 0.007
ulcerative colitis -1.300 0.000
ovarian cancer 1.500 0.012
head and neck cancer -1.200 0.000

Gene RIF (3)

PMID Text
26305679 a novel AR-interacting protein, Src homology 3 (SH3)-domain containing, Ysc84-like 1 (SH3YL1), whose interaction with the receptor is dependent upon this polyproline domain, was identified.
24508479 SH3YL1 promotes Dock4-mediated cell migration and promotes Dock4-mediated Rac1 activation.
21624956 results provide new insight into the SH3YL1 molecular mechanism of dorsal ruffle formation and its regulation by phosphoinositide metabolism

AA Sequence

MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVVA      1 - 70
RLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGN     71 - 140
VALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNRKFYCQDIRAYDILFGDTPRPAQAEDLYEILDSF    141 - 210
TEKYENEGQRINARKAAREQRKSSAKELPPKPLSRPQQSSAPVQLNSGSQSNRNEYKLYPGLSSYHERVG    211 - 280
NLNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMN            281 - 342
//

Text Mined References (16)

PMID Year Title
26305679 2015 Identification of a Novel Coregulator, SH3YL1, That Interacts With the Androgen Receptor N-Terminus.
25416956 2014 A proteome-scale map of the human interactome network.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24508479 2014 Dock4 forms a complex with SH3YL1 and regulates cancer cell migration.
21624956 2011 SH3YL1 regulates dorsal ruffle formation by a novel phosphoinositide-binding domain.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...