Property Summary

NCBI Gene PubMed Count 16
Grant Count 7
R01 Count 4
Funding $458,885.5
PubMed Score 13.86
PubTator Score 14.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 3.993 0.003
osteosarcoma -7.749 0.000
sarcoidosis 1.100 0.013
acute myeloid leukemia -3.400 0.029

Gene RIF (7)

PMID Text
25886616 Our data reveal MS4A3 as a novel direct target of EVI1 in human myeloid cells, and show that its repression plays a role in EVI1 mediated tumor aggressiveness.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19818099 High HTm4 is associated with neoplasms.
15830103 The C-terminal domain is important for the function of HTm4 in cell cycle regulation.
15671017 HTm4 binding to KAP.Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2

AA Sequence

MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLG      1 - 70
SLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLS     71 - 140
LNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSP    141 - 210
PNSV                                                                      211 - 214
//

Text Mined References (17)

PMID Year Title
25886616 2015 EVI1 promotes tumor growth via transcriptional repression of MS4A3.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
22367966 2012 Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19818099 2011 Characterization of the expression of HTm4 (MS4A3), a cell cycle regulator, in human peripheral blood cells and normal and malignant tissues.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15830103 2005 [Regulatory role of HTm4 gene in hematopoietic cell cycle].
More...