Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.58
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.28937116600526E-28
interstitial cystitis 2299 9.02255961935465E-5
ovarian cancer 8492 0.00158662692909914
oligodendroglioma 2849 0.00910078209025434
astrocytic glioma 2241 0.0100071814301384
group 3 medulloblastoma 2254 0.0133891084422658
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0221199368897702
Disease Target Count Z-score Confidence
Bladder carcinoma 3 3.063 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 0.010
oligodendroglioma -2.100 0.009
non-small cell lung cancer 2.428 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.022
interstitial cystitis -1.200 0.000
group 3 medulloblastoma 1.500 0.013
ovarian cancer 1.300 0.002

Synonym

Accession Q96HJ3 B2R8G2 Q8IX69 Q9H2A6 Q9Y599
Symbols L15
RAMA3
NY-REN-41

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken EggNOG Inparanoid

Gene RIF (1)

PMID Text
26312564 CCDC34 is up-regulated in bladder cancer and regulates bladder cancer cell proliferation, apoptosis and migration.

AA Sequence

MWAAGRWGPTFPSSYAGFSADCRPRSRPSSDSCSVPMTGARGQGLEVVRSPSPPLPLSCSNSTRSLLSPL      1 - 70
GHQSFQFDEDDGDGEDEEDVDDEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPES     71 - 140
RLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKKNEQKRKEREQK    141 - 210
INKEMEEKAAKELEKEYLQEKAKEKYQEWLKKKNAEECERKKKEKEKEKQQQAEIQEKKEIAEKKFQEWL    211 - 280
ENAKHKPRPAAKSYGYANGKLTGFYSGNSYPEPAFYNPIPWKPIHMPPPKEAKDLSGRKSKRPVISQPHK    281 - 350
SSSLVIHKARSNLCLGTLCRIQR                                                   351 - 373
//

Text Mined References (11)

PMID Year Title
26312564 2015 CCDC34 is up-regulated in bladder cancer and regulates bladder cancer cell proliferation, apoptosis and migration.
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11173847 2000 Cloning and characterization of the breakpoint regions of a chromosome 11;18 translocation in a patient with hamartoma of the retinal pigment epithelium.
More...