Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.38
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.700 1.0e-02
group 3 medulloblastoma 1.500 1.3e-02
interstitial cystitis -1.100 8.0e-03
intraductal papillary-mucinous carcinoma... 1.100 2.2e-02
non-small cell lung cancer 2.428 1.3e-28
oligodendroglioma -2.100 9.1e-03
ovarian cancer 1.300 1.6e-03

Gene RIF (1)

AA Sequence

MWAAGRWGPTFPSSYAGFSADCRPRSRPSSDSCSVPMTGARGQGLEVVRSPSPPLPLSCSNSTRSLLSPL      1 - 70
GHQSFQFDEDDGDGEDEEDVDDEEDVDEDAHDSEAKVASLRGMELQGCASTQVESENNQEEQKQVRLPES     71 - 140
RLTPWEVWFIGKEKEERDRLQLKALEELNQQLEKRKEMEEREKRKIIAEEKHKEWVQKKNEQKRKEREQK    141 - 210
INKEMEEKAAKELEKEYLQEKAKEKYQEWLKKKNAEECERKKKEKEKEKQQQAEIQEKKEIAEKKFQEWL    211 - 280
ENAKHKPRPAAKSYGYANGKLTGFYSGNSYPEPAFYNPIPWKPIHMPPPKEAKDLSGRKSKRPVISQPHK    281 - 350
SSSLVIHKARSNLCLGTLCRIQR                                                   351 - 373
//

Text Mined References (11)

PMID Year Title