Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.93
PubTator Score 7.62

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.2e-04
atypical teratoid / rhabdoid tumor -1.100 8.5e-06
Breast cancer 1.100 1.2e-05
ependymoma -1.100 2.0e-10
glioblastoma -1.200 6.6e-06
malignant mesothelioma 1.300 6.1e-07
medulloblastoma, large-cell -1.200 1.2e-04
non-small cell lung cancer 1.331 5.1e-12
osteosarcoma -1.210 2.6e-06

Gene RIF (6)

AA Sequence

MKKQRKILWRKGIHLAFSEKWNTGFGGFKKFYFHQHLCILKAKLGRPVTWNRQLRHFQGRKKALQIQKTW      1 - 70
IKDEPLCAKTKFNVATQNVSTLSSKVKRKDAKHFISSSKTLLRLQAEKLLSSAKNSDHEYCREKNLLKAV     71 - 140
TDFPSNSALGQANGHRPRTDPQPSDFPMKFNGESQSPGESGTIVVTLNNHKRKGFCYGCCQGPEHHRNGG    141 - 210
PLIPKKFQLNQHRRIKLSPLMMYEKLSMIRFRYRILRSQHFRTKSKVCKLRKAQRSWVQKVTGDHQETRR    211 - 280
ENGEGGSCSPFPSPEPKDPSCRHQPYFPDMDSSAVVKGTNSHVPDCHTKGSSFLGKELSLDEAFPDQQNG    281 - 350
SATNAWDQSSCSSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQTSSVSDDRVKLSVSGADT    351 - 420
SVSSVDGPVSQKAVQNENSYQMEEDGSLKQSILSSELLDHPYCKSPLEAPLVCSGLKLENQVGGGKNSQK    421 - 490
ASPVDDEQLSVCLSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYRARHQKCNF    491 - 560
RIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKVHFFNSFFHRQLVTKGYNGVKRWTKKVD    561 - 630
LFKKSLLLIPIHLEVHWSLITVTLSNRIISFYDSQGIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAV    631 - 700
TKCIPQQKNDSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCECRLMD                   701 - 755
//

Text Mined References (15)

PMID Year Title