Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.57
PubTator Score 0.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK      1 - 70
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ     71 - 140
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL    141 - 210
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN    211 - 280
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY    281 - 350
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI    351 - 420
QNNLQKLLENGD                                                              421 - 432
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...