Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.57
PubTator Score 0.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 1.69087464656813E-21
Breast cancer 3099 7.89516522177463E-21
medulloblastoma, large-cell 6234 6.64962830229381E-8
group 3 medulloblastoma 2254 2.66063851978303E-6
ulcerative colitis 2087 9.43563036009833E-6
atypical teratoid/rhabdoid tumor 1095 3.59063531919123E-5
tuberculosis and treatment for 3 months 327 9.47446465063304E-5
lung adenocarcinoma 2714 1.59252255996685E-4
interstitial cystitis 2299 3.10151071411409E-4
Down syndrome 548 3.16703290467173E-4
ovarian cancer 8492 3.35929888822497E-4
adrenocortical carcinoma 1427 0.00139509955823086
pituitary cancer 1972 0.00193405123868568
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00311556806927678
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00595130574574086
colon cancer 1475 0.00707468401774666
primitive neuroectodermal tumor 3031 0.016449835262132
ependymoma 2514 0.027025517568987
astrocytic glioma 2241 0.0469480209736901

Expression

  Differential Expression (19)

Synonym

Accession Q96HH9 B7Z1F2 B7Z3R1 B7Z6D8 B7Z8T2 D3DSZ3 Q9H753
Symbols NS3TP2

Gene

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK      1 - 70
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ     71 - 140
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL    141 - 210
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN    211 - 280
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY    281 - 350
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI    351 - 420
QNNLQKLLENGD                                                              421 - 432
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...