Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.04
PubTator Score 0.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.811 1.4e-03
astrocytic glioma 1.900 4.7e-02
atypical teratoid / rhabdoid tumor -2.200 1.6e-03
Breast cancer -2.200 7.9e-21
breast carcinoma -1.100 3.4e-03
colon cancer -1.300 7.1e-03
Down syndrome 2.100 3.2e-04
ependymoma 2.400 2.7e-02
group 3 medulloblastoma -3.000 2.7e-06
interstitial cystitis -1.100 3.1e-04
intraductal papillary-mucinous adenoma (... 1.400 3.1e-03
intraductal papillary-mucinous neoplasm ... 1.800 6.0e-03
lung adenocarcinoma 1.444 1.6e-04
medulloblastoma, large-cell -3.700 6.6e-08
ovarian cancer -1.500 3.4e-04
pituitary cancer -1.900 1.9e-03
primitive neuroectodermal tumor -1.800 1.6e-02
tuberculosis and treatment for 3 months -1.100 9.5e-05
ulcerative colitis -1.400 9.4e-06

Synonym

Accession Q96HH9 B7Z1F2 B7Z3R1 B7Z6D8 B7Z8T2 D3DSZ3 Q9H753
Symbols GRAMD3
NS3TP2

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (1)

AA Sequence

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPDQKKIISLWSK      1 - 70
SSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTEEPLKQSFTCALQKEILYQ     71 - 140
GKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTALLVPNALIIATVTDRYIFVSLLSRDSTYKLL    141 - 210
KSVCGHLENTSVGNSPNPSSAENSFRADRPSSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESEN    211 - 280
SRDFHATESQTVLNVSKGEAKPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFY    281 - 350
AIVVCALIISTFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI    351 - 420
QNNLQKLLENGD                                                              421 - 432
//

Text Mined References (23)

PMID Year Title