Property Summary

NCBI Gene PubMed Count 81
Grant Count 69
R01 Count 44
Funding $9,107,506.75
PubMed Score 143.47
PubTator Score 111.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96HF1 B3KQR2 O14778 Q9HAP5 FRP-2
Symbols FRP-2
SARP1
SDF-5

Gene

Gene RIF (63)

PMID Text
27042933 age-related increases in sFRP2 augment both angiogenesis and metastasis of melanoma cells
26763443 SFRP2 protein plays a role in the ultraviolet rays induced hyperpigmentary disorders.
26517501 Patients with Cytogenetically Normal Primary Acute Myeloid Leukemia and high sFRP2 expression had higher incidence of complete remission rate and better overall survival.
25788689 The distribution of Sfrp2 (and Sfrp1) in the eye is consistent with the idea that they modulate visual pathfinding and axon guidance.
25759530 A combination of GATA5 and SFRP2 methylation could be promising as a marker for the detection and diagnosis of colorectal cancers and adenomas.
25245632 Data suggest that overexpression of secreted frizzled-related protein 2 (sFRP2) gene in mesenchymal stem cells (hMSCs) might improve the therapeutic effectiveness of hMSC transplantation.
25197341 These findings suggest that decreased SFRP2 expression is associated with intermediate/poor karyotypes in acute myeloid leukemia
25189527 The role of SFRP2, as a functional tumor suppressor in the development of oral squamous cell carcinoma, is mediated through inhibition of the Wnt signaling pathway.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25053594 The risk size of SFRP2 hypermethylation from normal control to adenoma or polyp as well as from adenoma or polyp to colorectal cancer increased gradually
More...

AA Sequence

MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMK      1 - 70
EVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDML     71 - 140
ECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT    141 - 210
KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQ    211 - 280
REFKRISRSIRKLQC                                                           281 - 295
//

Text Mined References (81)

PMID Year Title
27042933 2016 sFRP2 in the aged microenvironment drives melanoma metastasis and therapy resistance.
26763443 2016 Secreted Frizzled-Related Protein 2 (sFRP2) Functions as a Melanogenic Stimulator; the Role of sFRP2 in UV-Induced Hyperpigmentary Disorders.
26517501 2015 Prognostic Significance of Secreted Frizzled-Related Protein 2 Expression in Cytogenetically Normal Primary Acute Myeloid Leukemia.
25788689 2015 Secreted frizzled related proteins modulate pathfinding and fasciculation of mouse retina ganglion cell axons by direct and indirect mechanisms.
25759530 2015 Combined detection of plasma GATA5 and SFRP2 methylation is a valid noninvasive biomarker for colorectal cancer and adenomas.
25245632 2015 Enhanced human mesenchymal stem cell survival under oxidative stress by overexpression of secreted frizzled-related protein 2 gene.
25197341 2014 Decreased SFRP2 expression is associated with intermediate and poor karyotypes in de novo acute myeloid leukemia.
25189527 2014 Secreted frizzled?related protein 2 is epigenetically silenced and functions as a tumor suppressor in oral squamous cell carcinoma.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25053594 2014 Variation risks of SFRP2 hypermethylation between precancerous disease and colorectal cancer.
More...