Property Summary

NCBI Gene PubMed Count 92
PubMed Score 153.96
PubTator Score 111.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.0
Obesity 678 0.0 1.5
Disease Target Count Z-score Confidence
Cancer 2499 4.307 2.2
Adenoma 167 3.625 1.8
Colorectal adenoma 15 3.049 1.5

Expression

  Differential Expression (29)

Protein-protein Interaction (3)

Gene RIF (74)

AA Sequence

MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMK      1 - 70
EVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDML     71 - 140
ECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDT    141 - 210
KIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQ    211 - 280
REFKRISRSIRKLQC                                                           281 - 295
//

Text Mined References (92)

PMID Year Title