Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.61
PubTator Score 6.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26252227 PRR11 may be widely activated in human gastric cancer.
26162986 PRR11-SKA2 bidirectional transcription unit, which is a novel direct target of NF-Y, is essential for the accelerated proliferation and motility of lung cancer cells
25973065 Targeted depletion of PRR11 caused a dramatic cell cycle arrest followed by massive apoptotic cell death, and eventually resulted in a significant decrease in growth and viability in lung cancer cell lines.
25971332 Microarray analysis revealed that several genes involved in cell proliferation, cell adhesion, and cell migration were altered in PRR11-knockout cells.
25674234 we found that increased expression of proline-rich protein 11 (PRR11) was associated with the progression of breast cancer and that PRR11 protein levels were significantly elevated in breast cancer
25666944 Overexpression of PRR11 inhibits cell proliferation and induces premature chromatin condensation.
23246489 our results strongly demonstrated that this newly identified gene, PRR11, had a critical role in both cell cycle progression and tumorigenesis, and might serve as a novel potential target in the diagnosis and/or treatment of human lung cancer.
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 10 is discussed

AA Sequence

MPKFKQRRRKLKAKAERLFKKKEASHFQSKLITPPPPPPSPERVGISSIDISQSRSWLTSSWNFNFPNIR      1 - 70
DAIKLWTNRVWSIYSWCQNCITQSLEVLKDTIFPSRICHRELYSVKQQFCILESKLCKLQEALKTISESS     71 - 140
SCPSCGQTCHMSGKLTNVPACVLITPGDSKAVLPPTLPQPASHFPPPPPPPPLPPPPPPLAPVLLRKPSL    141 - 210
AKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR    211 - 280
VTNVLITPGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLP    281 - 350
LSTSSFDEQN                                                                351 - 360
//

Text Mined References (22)

PMID Year Title
26252227 2015 PRR11 Is a Prognostic Marker and Potential Oncogene in Patients with Gastric Cancer.
26162986 2015 The gene pair PRR11 and SKA2 shares a NF-Y-regulated bidirectional promoter and contributes to lung cancer development.
25973065 2015 RNAi-mediated silencing of praline-rich gene causes growth reduction in human lung cancer cells.
25971332 2015 The prognostic potential and oncogenic effects of PRR11 expression in hilar cholangiocarcinoma.
25674234 2014 Proline-rich protein 11 regulates epithelial-to-mesenchymal transition to promote breast cancer cell invasion.
25666944 2015 PRR11 regulates late-S to G2/M phase progression and induces premature chromatin condensation (PCC).
23246489 2013 PRR11 is a novel gene implicated in cell cycle progression and lung cancer.
23242552 2013 Global subcellular characterization of protein degradation using quantitative proteomics.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...