Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.31
PubTator Score 6.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
adrenocortical carcinoma 2.777 4.8e-05
adult high grade glioma 1.900 6.8e-04
astrocytic glioma 1.700 7.5e-03
Atopic dermatitis 2.100 5.0e-05
atypical teratoid / rhabdoid tumor 2.000 6.6e-06
Breast cancer 2.700 9.3e-12
breast carcinoma 1.900 8.4e-31
ductal carcinoma in situ 2.200 2.7e-03
Endometriosis 1.633 6.7e-03
ependymoma 1.800 2.4e-03
esophageal adenocarcinoma 1.300 1.8e-02
glioblastoma 2.700 1.4e-10
group 3 medulloblastoma 3.700 1.2e-06
interstitial cystitis 1.600 7.6e-03
intraductal papillary-mucinous carcinoma... 1.200 1.7e-02
intraductal papillary-mucinous neoplasm ... 3.100 4.2e-03
invasive ductal carcinoma 2.600 5.9e-05
lung adenocarcinoma 1.300 4.9e-06
medulloblastoma, large-cell 3.300 2.1e-06
Multiple myeloma -1.605 8.5e-03
nasopharyngeal carcinoma 1.700 3.5e-05
non-small cell lung cancer 3.003 1.5e-32
oligodendroglioma 1.800 1.1e-03
osteosarcoma 1.397 2.2e-05
ovarian cancer -1.100 5.8e-03
pancreatic cancer 1.500 6.3e-05
pancreatic ductal adenocarcinoma liver m... 1.815 7.0e-04
Pick disease 1.100 3.5e-07
primary Sjogren syndrome 1.700 5.1e-04
primitive neuroectodermal tumor 2.500 1.9e-04
psoriasis 1.400 1.6e-37
tuberculosis 2.500 1.1e-06

Synonym

Accession Q96HE9 Q9NUZ7 Q9NXE9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MPKFKQRRRKLKAKAERLFKKKEASHFQSKLITPPPPPPSPERVGISSIDISQSRSWLTSSWNFNFPNIR      1 - 70
DAIKLWTNRVWSIYSWCQNCITQSLEVLKDTIFPSRICHRELYSVKQQFCILESKLCKLQEALKTISESS     71 - 140
SCPSCGQTCHMSGKLTNVPACVLITPGDSKAVLPPTLPQPASHFPPPPPPPPLPPPPPPLAPVLLRKPSL    141 - 210
AKALQAGPLKKDGPMQITVKDLLTVKLKKTQSLDEKRKLIPSPKARNPLVTVSDLQHVTLKPNSKVLSTR    211 - 280
VTNVLITPGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKFQLAHPRSPTPTLP    281 - 350
LSTSSFDEQN                                                                351 - 360
//

Text Mined References (23)

PMID Year Title