Property Summary

NCBI Gene PubMed Count 52
Grant Count 8
R01 Count 5
Funding $294,730.89
PubMed Score 31.40
PubTator Score 54.95

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96HE7 A8K9X4 A8MYW1 Q7LD45 Q9P1Q9 Q9UKV6 ERO1-L
Symbols ERO1L
ERO1-L
ERO1LA
Ero1alpha
ERO1-alpha
ERO1-L-alpha

Gene

PANTHER Protein Class (1)

PDB

3AHQ   3AHR  

Gene RIF (34)

PMID Text
26609561 Data indicate a new mechanism of Ero1alpha regulation in which thiol-disulfide exchange at Cys208-Cys241 affects the stability of the Cys94-Cys131 inhibitory disulfide through allosteric and/or inter-molecular communication.
25870246 the cancer-associated ERO1-alpha regulates the expression of the MHC class I molecule via oxidative folding
25595776 These results suggest that overexpression of ERO1-alpha in the tumor inhibits the T cell response by recruiting polymorphonuclear myeloid-derived suppressor cells
25387528 Data suggest that expression of ERO1alpha (oxidoreductin-1-L-alpha) and CHOP (c/EBP-homologous protein) is up-regulated in liver of patients with acute liver failure.
25258311 PDI has a role as a competent regulator and a specific substrate of Ero1alpha govern efficient and faithful oxidative protein folding and maintain the ER redox homeostasis
25122773 These results indicate that BPA, a widely distributed and potentially harmful chemical, inhibits Ero1-PDI-mediated disulfide bond formation.
24758166 A simple feedback mechanism of regulation of Ero1alpha was identified involving its primary substrate.
24022479 ER stress induced by misfolded proinsulin was limited by increased expression of Ero1alpha, suggesting that enhancing the oxidative folding of proinsulin may be a viable therapeutic strategy in the treatment of type 2 diabetes.
23979138 Data indicate that protein disulfide isomerase (PDI) and ERp44 dynamically localize Ero1alpha and peroxiredoxin 4 in early secretory compartment (ESC).
23919619 GPx7 promotes oxidative protein folding, directly utilizing Ero1alpha-generated hydrogen peroxide in the early secretory compartment.
More...

AA Sequence

MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLE      1 - 70
SDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAV     71 - 140
DESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFK    141 - 210
PQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHN    211 - 280
ITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHE    281 - 350
IKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKL    351 - 420
IANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH                          421 - 468
//

Text Mined References (60)

PMID Year Title
26609561 2016 Cysteines 208 and 241 in Ero1? are required for maximal catalytic turnover.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25870246 2015 Cancer-Associated Oxidase ERO1-? Regulates the Expression of MHC Class I Molecule via Oxidative Folding.
25595776 2015 Cancer-associated oxidoreductase ERO1-? drives the production of tumor-promoting myeloid-derived suppressor cells via oxidative protein folding.
25416956 2014 A proteome-scale map of the human interactome network.
25387528 2015 C/EBP homologous protein (CHOP) contributes to hepatocyte death via the promotion of ERO1? signalling in acute liver failure.
25258311 2014 Different interaction modes for protein-disulfide isomerase (PDI) as an efficient regulator and a specific substrate of endoplasmic reticulum oxidoreductin-1? (Ero1?).
25122773 2014 Inhibition of the functional interplay between endoplasmic reticulum (ER) oxidoreduclin-1? (Ero1?) and protein-disulfide isomerase (PDI) by the endocrine disruptor bisphenol A.
24758166 2014 Inactivation of mammalian Ero1? is catalysed by specific protein disulfide-isomerases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...