Property Summary

NCBI Gene PubMed Count 57
PubMed Score 34.54
PubTator Score 54.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 1.118 6.7e-03
adrenocortical carcinoma 1.041 2.1e-03
astrocytic glioma -1.200 3.4e-03
atypical teratoid / rhabdoid tumor 1.100 1.2e-02
Breast cancer 2.100 5.0e-02
diabetes mellitus -1.300 1.4e-02
ductal carcinoma in situ 1.100 3.1e-02
ependymoma -1.100 1.9e-02
glioblastoma 1.300 1.1e-03
intraductal papillary-mucinous adenoma (... 1.200 2.1e-02
intraductal papillary-mucinous carcinoma... 1.200 4.3e-03
intraductal papillary-mucinous neoplasm ... 2.700 4.0e-04
invasive ductal carcinoma 1.900 4.0e-04
lung adenocarcinoma 1.500 9.9e-07
medulloblastoma -1.100 7.7e-06
non-small cell lung cancer 1.751 4.5e-17
oligodendroglioma -1.200 8.6e-03
osteosarcoma -1.819 2.6e-06
ovarian cancer 2.300 1.9e-03
pancreatic cancer 1.600 3.0e-06
pediatric high grade glioma 1.100 2.6e-03
pituitary cancer 1.200 4.5e-03
primary pancreatic ductal adenocarcinoma 1.555 8.8e-03
psoriasis 1.900 2.0e-36
ulcerative colitis 2.100 5.3e-06

Gene RIF (40)

AA Sequence

MGRGWGFLFGLLGAVWLLSSGHGEEQPPETAAQRCFCQVSGYLDDCTCDVETIDRFNNYRLFPRLQKLLE      1 - 70
SDYFRYYKVNLKRPCPFWNDISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAV     71 - 140
DESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEYVDLLLNPERYTGYKGPDAWKIWNVIYEENCFK    141 - 210
PQTIKRPLNPLASGQGTSEENTFYSWLEGLCVEKRAFYRLISGLHASINVHLSARYLLQETWLEKKWGHN    211 - 280
ITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHE    281 - 350
IKSFPLHFDENSFFAGDKKEAHKLKEDFRLHFRNISRIMDCVGCFKCRLWGKLQTQGLGTALKILFSEKL    351 - 420
IANMPESGPSYEFHLTRQEIVSLFNAFGRISTSVKELENFRNLLQNIH                          421 - 468
//

Text Mined References (65)

PMID Year Title