Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.54
PubTator Score 8.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
active ulcerative colitis 477

Expression

  Differential Expression (1)

Disease log2 FC p
active ulcerative colitis 1.494 0.028

Synonym

Accession Q96HD9
Symbols ACY-3
HCBP1

Gene

Gene RIF (1)

PMID Text
19486448 Suggest that ACY3 is an HCV core binding protein, which may play a role in the development of HCV-associated diseases.

AA Sequence

MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLN      1 - 70
RTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLC     71 - 140
RHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFN    141 - 210
QGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYP    211 - 280
VFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS                                   281 - 319
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19486448 2009 Identification of a novel protein binding to hepatitis C virus core protein.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14656720 2004 Structural characterization, tissue distribution, and functional expression of murine aminoacylase III.
More...