Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.57
PubTator Score 8.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
active ulcerative colitis 764 2.8e-02

Expression

  Differential Expression (1)

Disease log2 FC p
active ulcerative colitis 1.494 2.8e-02

Gene RIF (1)

AA Sequence

MCSLPVPREPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLN      1 - 70
RTFTSSFLNSRPTPDDPYEVTRARELNQLLGPKASGQAFDFVLDLHNTTANMGTCLIAKSSHEVFAMHLC     71 - 140
RHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELGPQPQGVLRADIFSRMRTLVATVLDFIELFN    141 - 210
QGTAFPAFEMEAYRPVGVVDFPRTEAGHLAGTVHPQLQDRDFQPLQPGAPIFQMFSGEDLLYEGESTVYP    211 - 280
VFINEAAYYEKGVAFVQTEKFTFTVPAMPALTPAPSPAS                                   281 - 319
//

Text Mined References (14)

PMID Year Title