Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.91
PubTator Score 2.10

Knowledge Summary


No data available



Accession Q96HA9 Q8NDM0


  Ortholog (13)

Gene RIF (2)

20826455 coordinates peroxisome membrane proliferation and maintenance
12559946 Data show that Pex11pgamma is a peroxisomal membrane protein, with both the N- and C-termini exposed to the cytosol.

AA Sequence

PWLVGLMGTISSILSMYQAARAGGQAEATTP                                           211 - 241

Text Mined References (7)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20826455 2010 PEX11 family members are membrane elongation factors that coordinate peroxisome proliferation and maintenance.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12559946 2003 cDNA cloning and characterization of the third isoform of human peroxin Pex11p.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417726 2002 PEX11alpha is required for peroxisome proliferation in response to 4-phenylbutyrate but is dispensable for peroxisome proliferator-activated receptor alpha-mediated peroxisome proliferation.