Property Summary

NCBI Gene PubMed Count 12
Grant Count 6
R01 Count 5
Funding $636,544.5
PubMed Score 2.79
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis 1.300 0.000
non-small cell lung cancer 1.075 0.000
lung cancer 1.800 0.000
invasive ductal carcinoma 1.300 0.016
ovarian cancer 1.700 0.001

Gene RIF (1)

PMID Text
25356641 the peptide backbone recognition patch of hNtaq1 forms nonspecific interactions with N-terminal peptides of substrate proteins

AA Sequence

MEGNGPAAVHYQPASPPRDACVYSSCYCEENIWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQAR      1 - 70
PGDGPVIWDYHVVLLHVSSGGQNFIYDLDTVLPFPCLFDTYVEDAFKSDDDIHPQFRRKFRVIRADSYLK     71 - 140
NFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC         141 - 205
//

Text Mined References (14)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
25356641 2014 Crystal structure of human protein N-terminal glutamine amidohydrolase, an initial component of the N-end rule pathway.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19060904 2009 An empirical framework for binary interactome mapping.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...