Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MALRHLALLAGLLVGVASKSMENTVTRNSTAVINTQAEGTLSPPGLSSLPVVREWALTHTAQLPECCVDV      1 - 70
VGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAGPGAPFPMNRSSGTPGRPHPG     71 - 140
APRVAASLFLGTFFISSGLILSVAGFFYLKRSSKLPRACYRRNKAPALQPGEAAAMIPPPQSSGNSSCRI    141 - 210
PLWGFPSLGQSQGALWVCPQTGLPGSGSRPPLPGSPGDPPTRQGQGRIWLVPPALDLSWIWPAPPARPPL    211 - 280
IPVTSMLFPVPETWGLQERRTHHDRADPQYLLLLEVQLHPRTDAAGLRQALLSSHRFSGAGSGGPKSQPV    281 - 350
RKPRYVRRERPLDRATDPAAFPGEARISNV                                            351 - 380
//

Text Mined References (7)

PMID Year Title