Property Summary

NCBI Gene PubMed Count 31
PubMed Score 37.76
PubTator Score 51.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 4.83481013477988E-6
Disease Target Count Z-score Confidence
Rheumatic heart disease 8 3.274 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer -1.100 0.000

Synonym

Accession Q96HA1 A6NFS9 A8CDT4 A8K933 A8MXF9 O75115 Q96DI0 Q9H9X1 Q9Y2N3 Q9Y4S7
Symbols P145
POM121A

Gene

  Ortholog (2)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid

Gene RIF (5)

PMID Text
26179916 The conserved features of the NLSs of ScHeh1, ScHeh2, and RnPom121 and the effective sorting of Heh2-derived reporters in human cells suggest that active import is conserved but confined to a small subset of INM proteins.
21289085 Data suggest that the nuclear migration of Pom121 and its subsequent interaction with inner nuclear membrane proteins are required to initiate interphase nuclear pore complex assembly.
20974814 The the N terminus of Pom121 directly binds the beta-propeller regions of Nup155 and Nup160.
20624389 The nuclear localization signal sites of Pom121 affect its function in nuclear pore complex assembly both by influencing nucleoporin interactions and pore membrane structure.
17900573 RNAi experiments showed that efficient depletion of both Pom121 proteins significantly reduces assembled nuclear pore complexes on nuclear envelope.

AA Sequence

MSPAAAAAGAGERRRPIASVRDGRGRGCGGPARAVLLGLSLVGLLLYLVPAAAALAWLTVGATAAWWGLS      1 - 70
REPRGSRPLSSFVRKARHRRPLSSFVRKARHRRTLFASPLAKSTANGNLLEPRTLLEGPDPAELLLMGSY     71 - 140
LGKPGPPQPAAAPEGQDLRDRPGRRPPARPAPRSPPPRSPPPRSPPPSPPTHRAHHVYPSLPTPLLRPSR    141 - 210
RPSPRDCGTLPNRFVITPRRRYPIHQAQYSCLGVLPTVCWNGYHKKAVLSPRNSRMVCSPVTVRIAPPDR    211 - 280
RFSRSAIPEQIISSTLSSPSSNAPDPCAKETVLSALKEKEKKRTVEEEDQIFLDGQENKRRRHDSSGSGH    281 - 350
SAFEPLVANGVPASFVPKPGSLKRGLNSQSSDDHLNKRSRSSSMSSLTGAYASGIPSSSRNAITSSYSST    351 - 420
RGISQLWKRNGPSSSPFSSPASSRSQTPERPAKKIREEELCHHSSSSTPLAADRESQGEKAADTTPRKKQ    421 - 490
NSNSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSDAASN    491 - 560
SVTETPPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEALSPPKT    561 - 630
PSLLPPLGLSQSGPPGLLPSPSFDSKPPTTLLGLIPAPSMVPATDTKAPPTLQAETATKPQATSAPSPAP    631 - 700
KQSFLFGTQNTSPSSPAAPAASSAPPMFKPIFTAPPKSEKEGPTPPGPSVTATAPSSSSLPTTTSTTAPT    701 - 770
FQPVFSSMGPPASVPLPAPFFKQTTTPATAPTTTAPLFTGLASATSAVAPITSASPSTDSASKPAFGFGI    771 - 840
NSVSSSSVSTTTSTATAASQPFLFGAPQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLHTAVPTA    841 - 910
TSSSAADFSGFGSTLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPP    911 - 980
GAAKPALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPAYVPTPIHPIFGGATHSAFGLKATASAFGAP    981 - 1050
ASSQPAFGGSTAVFFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINVATPGS   1051 - 1120
STTTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNVSSTTESKPVFGGTATPTFGLNTPAP   1121 - 1190
GVGTSGSSLSFGASSAPAQGFVGVAPFGSAALSFSIGAGSKTPGARQRLQARRQHTRKK              1191 - 1249
//

Text Mined References (38)

PMID Year Title
26179916 2015 Conservation of inner nuclear membrane targeting sequences in mammalian Pom121 and yeast Heh2 membrane proteins.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21727197 2011 POM121 and Sun1 play a role in early steps of interphase NPC assembly.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21289085 2011 Localization of Pom121 to the inner nuclear membrane is required for an early step of interphase nuclear pore complex assembly.
20974814 2010 Pom121 links two essential subcomplexes of the nuclear pore complex core to the membrane.
20624389 2010 NLS-mediated NPC functions of the nucleoporin Pom121.
More...