Property Summary

NCBI Gene PubMed Count 32
PubMed Score 132.22
PubTator Score 82.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Coenzyme Q10 deficiency disease 8 5.702 2.9
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Parkinson's disease 392 0.0 4.0

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.700 6.6e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.7e-03
osteosarcoma -1.675 6.2e-04
ovarian cancer 1.600 4.9e-04
subependymal giant cell astrocytoma 2.096 8.2e-03

Gene RIF (22)

AA Sequence

MLGSRAAGFARGLRALALAWLPGWRGRSFALARAAGAPHGGDLQPPACPEPRGRQLSLSAAAVVDSAPRP      1 - 70
LQPYLRLMRLDKPIGTWLLYLPCTWSIGLAAEPGCFPDWYMLSLFGTGAILMRGAGCTINDMWDQDYDKK     71 - 140
VTRTANRPIAAGDISTFQSFVFLGGQLTLALGVLLCLNYYSIALGAGSLLLVITYPLMKRISYWPQLALG    141 - 210
LTFNWGALLGWSAIKGSCDPSVCLPLYFSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLS    211 - 280
GFSVAMLGALSLVGVNSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFISNRTLGLIVFLGIVLG    281 - 350
NLWKEKKTDKTKKGIENKIEN                                                     351 - 371
//

Text Mined References (33)

PMID Year Title