Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.47
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.500 2.8e-05
osteosarcoma -1.112 3.0e-05
posterior fossa group B ependymoma 1.200 7.1e-07
primitive neuroectodermal tumor 1.100 2.3e-03

Gene RIF (1)

AA Sequence

MAPPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALYRDVMRETYGHLSALGIGGN      1 - 70
KPALISWVEEEAELWGPAAQDPEVAKCQTQTDPADSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQAP     71 - 140
SAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRHGCYVCGKSFAWRSTLVEHVYSHTGEKPFHCTDCGK    141 - 210
GFGHASSLSKHRAIHRGERPHRCLECGRAFTQRSALTSHLRVHTGEKPYGCADCGRRFSQSSALYQHRRV    211 - 280
HSGETPFPCPDCGRAFAYPSDLRRHVRTHTGEKPYPCPDCGRCFRQSSEMAAHRRTHSGEKPYPCPQCGR    281 - 350
RFGQKSAVAKHQWVHRPGAGGHRGRVAGRLSVTLTPGHGDLDPPVGFQLYPEIFQECG                351 - 408
//

Text Mined References (6)

PMID Year Title