Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.47
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 4.48622164492187E-10
posterior fossa group B ependymoma 1530 7.13923244900806E-7
group 3 medulloblastoma 2254 2.79649173751254E-5
primitive neuroectodermal tumor 3031 0.00225989149614029
Disease Target Count Z-score Confidence
Thyroid Hormone Resistance Syndrome 4 4.731 2.4

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.804 0.000
group 3 medulloblastoma 1.500 0.000
primitive neuroectodermal tumor 1.100 0.002
posterior fossa group B ependymoma 1.200 0.000

Synonym

Accession Q96H86 A8MZF4 B3KSN2 H9KV99 Q9BWS1
Symbols

Gene

  Ortholog (3)

Species Source
Mouse OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG

Gene RIF (1)

PMID Text
22577170 effect of ZNF764 on the glucocorticoid receptor transcriptional activity was mediated through cooperation with a general nuclear hormone receptor coactivator, transcriptional intermediary factor 1

AA Sequence

MAPPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALYRDVMRETYGHLSALGIGGN      1 - 70
KPALISWVEEEAELWGPAAQDPEVAKCQTQTDPADSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQAP     71 - 140
SAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRHGCYVCGKSFAWRSTLVEHVYSHTGEKPFHCTDCGK    141 - 210
GFGHASSLSKHRAIHRGERPHRCLECGRAFTQRSALTSHLRVHTGEKPYGCADCGRRFSQSSALYQHRRV    211 - 280
HSGETPFPCPDCGRAFAYPSDLRRHVRTHTGEKPYPCPDCGRCFRQSSEMAAHRRTHSGEKPYPCPQCGR    281 - 350
RFGQKSAVAKHQWVHRPGAGGHRGRVAGRLSVTLTPGHGDLDPPVGFQLYPEIFQECG                351 - 408
//

Text Mined References (6)

PMID Year Title
22577170 2012 ZNF764 haploinsufficiency may explain partial glucocorticoid, androgen, and thyroid hormone resistance associated with 16p11.2 microdeletion.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.