Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.20
PubTator Score 0.32

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
Testicular germ cell tumor 23
Disease Target Count P-value
osteosarcoma 7933 7.72118573722165E-8
medulloblastoma, large-cell 6234 6.874364544802E-6
atypical teratoid / rhabdoid tumor 4369 8.70145160913133E-6
psoriasis 6685 4.75584234027735E-5
ovarian cancer 8492 4.86499045963253E-5
glioblastoma 5572 7.08099334254064E-5
lung cancer 4473 1.50528250959449E-4
medulloblastoma 1524 2.43409511796792E-4
adult high grade glioma 2148 3.91546154116461E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00119120943938076
Disease Target Count Z-score Confidence
Cerebral amyloid angiopathy 9 3.384 1.7


  Differential Expression (10)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -1.945 0.000
medulloblastoma -1.500 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -2.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.140 0.001
lung cancer -1.500 0.000
adult high grade glioma -1.100 0.000
ovarian cancer 2.200 0.000


Accession Q96H78 O75034


  Ortholog (10)

Gene RIF (2)

23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

RIISATPSTIVIVVGYESLKKLSLRPELVDSRHW                                        281 - 314

Text Mined References (10)

PMID Year Title
24656865 2014 Meta-analysis of genome-wide association studies identifies 1q22 as a susceptibility locus for intracerebral hemorrhage.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.