Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.20
PubTator Score 0.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.100 3.9e-04
atypical teratoid / rhabdoid tumor -1.700 8.7e-06
glioblastoma -1.300 7.1e-05
group 4 medulloblastoma -1.100 2.0e-04
lung cancer -1.500 1.5e-04
medulloblastoma, large-cell -1.200 2.9e-04
osteosarcoma -1.588 6.2e-07
ovarian cancer -1.300 2.3e-08
pancreatic ductal adenocarcinoma liver m... -1.140 1.2e-03
psoriasis -1.700 4.8e-05

 GO Process (1)

Gene RIF (2)

AA Sequence

MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFIKILRADGI      1 - 70
TGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQ     71 - 140
RKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQ    141 - 210
LSYLCPKECPHIVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLMKGLSA    211 - 280
RIISATPSTIVIVVGYESLKKLSLRPELVDSRHW                                        281 - 314
//

Text Mined References (10)

PMID Year Title