Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
Funding $353,274
PubMed Score 6.96
PubTator Score 5.18

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
26659663 Myo19 is a stably attached OMM molecular motor.
25447992 Myo19 is a novel regulator of cell division.
19932026 These results suggest that this novel myosin functions as an actin-based motor for mitochondrial movement in vertebrate cells.

AA Sequence

MLQQVNGHNPGSDGQAREYLREDLQEFLGGEVLLYKLDDLTRVNPVTLETVLRCLQARYMADTFYTNAGC      1 - 70
TLVALNPFKPVPQLYSPELMREYHAAPQPQKLKPHVFTVGEQTYRNVKSLIEPVNQSIVVSGESGAGKTW     71 - 140
TSRCLMKFYAVVATSPASWESHKIAERIEQRILNSNPVMEAFGNACTLRNNNSSRFGKFIQLQLNRAQQM    141 - 210
TGAAVQTYLLEKTRVACQASSERNFHIFYQICKGASEDERLQWHLPEGAAFSWLPNPERSLEEDCFEVTR    211 - 280
EAMLHLGIDTPTQNNIFKVLAGLLHLGNIQFAASEDEAQPCQPMDDAKYSVRTAASLLGLPEDVLLEMVQ    281 - 350
IRTIRAGRQQQVFRKPCARAECDTRRDCLAKLIYARLFDWLVSVINSSICADTDSWTTFIGLLDVYGFES    351 - 420
FPDNSLEQLCINYANEKLQQHFVAHYLRAQQEEYAVEGLEWSFINYQDNQPCLDLIEGSPISICSLINEE    421 - 490
CRLNRPSSAAQLQTRIETALAGSPCLGHNKLSREPSFIVVHYAGPVRYHTAGLVEKNKDPIPPELTRLLQ    491 - 560
QSQDPLLMGLFPTNPKEKTQEEPPGQSRAPVLTVVSKFKASLEQLLQVLHSTTPHYIRCIKPNSQGQAQT    561 - 630
FLQEEVLSQLEACGLVETIHISAAGFPIRVSHRNFVERYKLLRRLHPCTSSGPDSPYPAKGLPEWCPHSE    631 - 700
EATLEPLIQDILHTLPVLTQAAAITGDSAEAMPAPMHCGRTKVFMTDSMLELLECGRARVLEQCARCIQG    701 - 770
GWRRHRHREQERQWRAVMLIQAAIRSWLTRKHIQRLHAAATVIKRAWQKWRIRMACLAAKELDGVEEKHF    771 - 840
SQAPCSLSTSPLQTRLLEAIIRLWPLGLVLANTAMGVGSFQRKLVVWACLQLPRGSPSSYTVQTAQDQAG    841 - 910
VTSIRALPQGSIKFHCRKSPLRYADICPEPSPYSITGFNQILLERHRLIHVTSSAFTGLG              911 - 970
//

Text Mined References (12)

PMID Year Title
26659663 2016 Myo19 is an outer mitochondrial membrane motor and effector of starvation-induced filopodia.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25447992 2014 Myo19 ensures symmetric partitioning of mitochondria and coupling of mitochondrial segregation to cell division.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19932026 2009 Human Myo19 is a novel myosin that associates with mitochondria.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17877792 2007 Drawing the tree of eukaryotic life based on the analysis of 2,269 manually annotated myosins from 328 species.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...