Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 484 6.4e-03
acute myeloid leukemia 783 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia -2.100 2.2e-02
mucosa-associated lymphoid tissue lympho... -1.056 6.4e-03

AA Sequence

MPGPLRSLEMESLQFRDVAVEFSLEEWHCLDTAQQNLYRDVMLENYRHLVFLGIIVSKPDLITCLEQGIK      1 - 70
PLTMKRHEMIAKPPVVCSHFAQDLWPEQSIKDSYQKVILRKFEKCGHGNLHFKKGCESVDECKLHKRGYN     71 - 140
GLNQCLTTTQSKIFQCGKYVKVFHQFSNSKRHKRRHTEKKPLKYIEGDKAFNQSSTHTTHKKIDTGEKPY    141 - 210
KCEECGKAFNRSSHLTTHKITHTREKPYKCEECGKVFKYFSSFTTHKKIHSGEKPYICEECGKAFMYPYT    211 - 280
LTTHKIIHTGEQPYKCKECDKAFNHPATLSSHKKIHTGEKPYTCDKCGKAFISSSILSKHEKIHTGEKPY    281 - 350
KCEECGKAFTRSSHLTMHKIIHTGEKPYKCEECGKAFTWSAGLHKHRRTHTGEKPYKCEECGKAYTTSSN    351 - 420
LTEHKTTHTGEKPYKCKECGKAFNWSSDLNKHKRIHIGQKPRT                               421 - 463
//

Text Mined References (4)

PMID Year Title