Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.96
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96H22 A8MZE6 B3KN53 B4DJD1 B4DPY7 C9JJM5 D3DUK8 E7ES30 E7ETS3 Q9NZ83 CENP-N
Symbols BM039
CENP-N
ICEN32
C16orf60

Gene

Gene RIF (3)

PMID Text
26698661 Study demonstrate that the CENP-L-N complex plays a crucial role at the core of the 16-subunit Constitutive Centromere-Associated Network through interactions with CENP-C and CENP-H-I-KM.
22100916 CENP-N is bound to kinetochores during S phase and G2, but is absent from kinetochores during mitosis and G1.
19543270 Data suggest that CENP-N interprets the information encoded within CENP-A nucleosomes and recruits other proteins to centromeric chromatin that are required for centromere function and propagation.

AA Sequence

MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLD      1 - 70
IIYMQFHQHQKVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQ     71 - 140
YTKPNQYKPTYVVYYSQTPYAFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYN    141 - 210
QTFETHNSTTPLQERSLGLDINMDSRIIHENIVEKERVQRITQETFGDYPQPQLEFAQYKLETKFKSGLN    211 - 280
GSILAEREEPLRCLIKFSSPHLLEALKSLAPAGIADAPLSPLLTCIPNKRMNYFKIRDK               281 - 339
//

Text Mined References (20)

PMID Year Title
27499292 2016 The Flexible Ends of CENP-A Nucleosome Are Required for Mitotic Fidelity.
26698661 2015 The CENP-L-N Complex Forms a Critical Node in an Integrated Meshwork of Interactions at the Centromere-Kinetochore Interface.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22426531 2012 A conserved role for COMA/CENP-H/I/N kinetochore proteins in the spindle checkpoint.
22100916 2011 Dynamics of CENP-N kinetochore binding during the cell cycle.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19543270 2009 Centromere assembly requires the direct recognition of CENP-A nucleosomes by CENP-N.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...