Property Summary

NCBI Gene PubMed Count 37
PubMed Score 23.41
PubTator Score 16.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4740 2.0e-03
ovarian cancer 8520 2.8e-03

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 2.0e-03
ovarian cancer 1.200 2.8e-03

Gene RIF (10)

AA Sequence

MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD      1 - 70
MCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVS     71 - 140
QDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERAR    141 - 210
QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP                          211 - 258
//

Text Mined References (40)

PMID Year Title