Property Summary

NCBI Gene PubMed Count 35
PubMed Score 24.45
PubTator Score 16.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 0.002
ovarian cancer 1.200 0.003

Synonym

Accession Q96H20 Q8IXY3 Q9UN50
Symbols Dot3
EAP30
VPS22

Gene

PDB

2ZME   3CUQ  

Gene RIF (11)

PMID Text
26268989 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
26268989 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
26268989 shRNA knockdown of SNF8 (ESCRT-II component) impairs intracellular and extracellular (supernatant) HIV-1 CA-p24 production when using VSV-pseudotyped virus; replication is enhanced by SNF8
25232011 Taken together, these data suggest an active role for ESCRT-II and CHMP6 in ESCRT-mediated abscission
23305486 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
23171048 Modulating SNF8 expression levels alters the TRPC6 channel current and can modulate activation of NFAT-mediated transcription downstream of gain-of-function mutant TRPC6.
22978549 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
22978549 Knockdown of SNF8 (ESCRT-II component) decreases extracellular HIV-1 CA-p24 levels when using VSV-pseudotyped virus
17714434 Vps22 has an important role in ligand-induced EGFR and CXCR4 turnover; termination of EGF signaling occurs prior to ESCRT-II engagement
16973552 there are probably multiple pathways for protein sorting/multivesicular body vesicle formation in human cells and that human immunodeficiency virus type 1 does not utilize an ESCRT-II-dependent pathway to leave the cell
More...

AA Sequence

MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD      1 - 70
MCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVS     71 - 140
QDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERAR    141 - 210
QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP                          211 - 258
//

Text Mined References (38)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25232011 2014 Inhibition of ESCRT-II-CHMP6 interactions impedes cytokinetic abscission and leads to cell death.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23667179 2013 Identification of CAD candidate genes in GWAS loci and their expression in vascular cells.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23171048 2012 SNF8, a member of the ESCRT-II complex, interacts with TRPC6 and enhances its channel activity.
22978549 2012 ESCRT-II's involvement in HIV-1 genomic RNA trafficking and assembly.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...