Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.98
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 3 medulloblastoma 2254 1.2273688006806E-6
pediatric high grade glioma 2712 1.83293179623186E-6
atypical teratoid / rhabdoid tumor 4369 1.94003010710407E-6
ulcerative colitis 2087 4.46305478105503E-5
glioblastoma 5572 6.00688712201436E-5
primitive neuroectodermal tumor 3031 7.45218553298315E-5
osteosarcoma 7933 0.00369411602780828
subependymal giant cell astrocytoma 2287 0.0213438504727211
Disease Target Count Z-score Confidence
Acinar cell carcinoma 2 3.585 1.8

Expression

  Differential Expression (8)

Synonym

Accession Q96H12 B2RC35 Q5T726 Q5T727 Q5T728
Symbols L8
C9orf30

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

MQNNEIIKPAKYFSELEKSILLALVEKYKYVLECKKSDARTIALKQRTWQALAHEYNSQPSVSLRDFKQL      1 - 70
KKCWENIKARTKKIMAHERREKVKRSVSPLLSTHVLGKEKIASMLPEQLYFLQSPPEEEPEYHPDASAQE     71 - 140
SFAVSNRELCDDEKEFIHFPVCEGTSQPEPSCSAVRITANKNYRSKTSQEGALKKMHEEEHHQQMSILQL    141 - 210
QLIQMNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP         211 - 275
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...