Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.80
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.4e-06
glioblastoma 5792 6.3e-03
subependymal giant cell astrocytoma 2287 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Nephronophthisis 80 3.83 1.9
Eclampsia 6 3.015 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma -1.100 6.3e-03
malignant mesothelioma 1.300 1.4e-06
subependymal giant cell astrocytoma -1.206 1.1e-02

AA Sequence

MDGTETRQRRLDSCGKPGELGLPHPLSTGGLPVASEDGALRAPESQSVTPKPLETEPSRETTWSIGLQVT      1 - 70
VPFMFAGLGLSWAGMLLDYFQHWPVFVEVKDLLTLVPPLVGLKGNLEMTLASRLSTAANTGQIDDPQEQH     71 - 140
RVISSNLALIQVQATVVGLLAAVAALLLGVVSREEVDVAKVELLCASSVLTAFLAAFALGVLMVCIVIGA    141 - 210
RKLGVNPDNIATPIAASLGDLITLSILALVSSFFYRHKDSRYLTPLVCLSFAALTPVWVLIAKQSPPIVK    211 - 280
ILKFGWFPIILAMVISSFGGLILSKTVSKQQYKGMAIFTPVICGVGGNLVAIQTSRISTYLHMWSAPGVL    281 - 350
PLQMKKFWPNPCSTFCTSEINSMSARVLLLLVVPGHLIFFYIIYLVEGQSVINSQTFVVLYLLAGLIQVT    351 - 420
ILLYLAEVMVRLTWHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFICTQHLIV    421 - 490
SLLSFYFPFCLLAKTSI                                                         491 - 507
//

Text Mined References (8)

PMID Year Title