Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.42
PubTator Score 0.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 1.84156865610278E-5
adrenocortical carcinoma 1427 2.36006890912159E-5
atypical teratoid / rhabdoid tumor 4369 1.01230218942696E-4
adult high grade glioma 2148 2.78138569636978E-4
ovarian cancer 8492 9.20710207567996E-4
cutaneous lupus erythematosus 1056 0.00113991422699663
glioblastoma 5572 0.00285530755934116
acute myeloid leukemia 785 0.00296807333341018
medulloblastoma, large-cell 6234 0.00531863429951038
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00768495651982026
chronic rhinosinusitis 512 0.00853973032354001
lung cancer 4473 0.010145977271909
cystic fibrosis and chronic rhinosinusitis 213 0.010512522547097

Expression

Synonym

Accession Q96GY0 Q9Y372
Symbols CGI-62
C8orf70
FAM164A

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPR      1 - 70
PEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINF     71 - 140
CKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSS    141 - 210
SSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSL    211 - 280
NGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL                             281 - 325
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...