Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.29
PubTator Score 10.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
cystic fibrosis 1696 0.0 3.0
Disease Target Count Z-score Confidence
Chromosome 17q11.2 deletion syndrome, 1.4Mb 15 4.385 2.2

Expression

Protein-protein Interaction (6)

Gene RIF (8)

AA Sequence

MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP      1 - 70
EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM     71 - 140
IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTM    141 - 210
CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV                                          211 - 242
//

Text Mined References (25)

PMID Year Title