Property Summary

NCBI Gene PubMed Count 18
Grant Count 6
R01 Count 6
Funding $1,310,725.33
PubMed Score 9.52
PubTator Score 10.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (7)

PMID Text
24367089 APIP/MtnB functions as a cell death inhibitor independently of its MtnB enzyme activity for apoptosis induced by either hypoxia or etoposide, but dependently for caspase-1-induced pyroptosis
23285211 these results confirm the involvement of APIP in the methionine salvage pathway, which plays a key role in many biological functions like cancer, apoptosis, microbial proliferation and inflammation.
23192037 human APIP was overproduced in Escherichia coli, purified and crystallized. An X-ray diffraction data set was collected to 2.40 A resolution
22837397 A polymorphism associated with reduced expression of a putative methionine salvage pathway dehydratase, apoptotic protease activating factor 1 (APAF1)-interacting protein (APIP), was associated with increased caspase-1-mediated cell death in Salmonella.
22407486 The down-regulation of APIP and UACA expression suggests that the threshold to activate the apoptosome apparatus may be decreased in non-small cell lung cancer cells.
20800603 Observational study of gene-disease association. (HuGE Navigator)
15262985 APIP functions to inhibit muscle ischemic damage by binding to Apaf-1 in the Apaf-1/caspase-9 apoptosis pathway.

AA Sequence

MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP      1 - 70
EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM     71 - 140
IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTM    141 - 210
CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV                                          211 - 242
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24367089 2014 Structural and biochemical basis for the inhibition of cell death by APIP, a methionine salvage enzyme.
23285211 2012 Functional identification of APIP as human mtnB, a key enzyme in the methionine salvage pathway.
23192037 2012 Crystallization and preliminary X-ray crystallographic analysis of human Apaf-1-interacting protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22837397 2012 Functional genetic screen of human diversity reveals that a methionine salvage enzyme regulates inflammatory cell death.
22407486 2012 Down-regulated expression of apoptosis-associated genes APIP and UACA in non-small cell lung carcinoma.
21602797 2011 Genome-wide association and linkage identify modifier loci of lung disease severity in cystic fibrosis at 11p13 and 20q13.2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...