Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.15
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 6.0e-08
cystic fibrosis 1696 4.3e-04
interstitial cystitis 2312 1.2e-03

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 1.006 4.3e-04
interstitial cystitis -1.400 1.2e-03
osteosarcoma -1.467 6.0e-08

Gene RIF (1)

AA Sequence

MGLKMSCLKGFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDG      1 - 70
EIDPEA                                                                     71 - 76
//

Text Mined References (8)

PMID Year Title