Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.31
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.467 0.000
cystic fibrosis 1.006 0.000
interstitial cystitis -1.600 0.000

Synonym

Accession Q96GX8
Symbols

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
21203532 C16orf74 expression level represents a potentially useful marker for predicting progression in primary non-muscle invasive bladder cancer patients

AA Sequence

MGLKMSCLKGFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWLDETGSCPDDG      1 - 70
EIDPEA                                                                     71 - 76
//

Text Mined References (8)

PMID Year Title
21203532 2010 Identification of C16orf74 as a marker of progression in primary non-muscle invasive bladder cancer.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.