Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.06
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.500 0.003
oligodendroglioma 1.200 0.026
psoriasis 1.200 0.012
osteosarcoma 3.185 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
glioblastoma -1.100 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.001
lung cancer 1.300 0.000
adult high grade glioma -1.500 0.001
subependymal giant cell astrocytoma -1.569 0.008
ovarian cancer 1.300 0.000

Synonym

Accession Q96GX2
Symbols lnc-SCA7

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
23475819 This family's complex phenotype is associated with a new chromosomal deletion, which suggests potential roles for the two genes, KCNC2 and ATXN7L3B, in human neurological disease.

AA Sequence

MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFGIQPVEDKGAC      1 - 70
RLPLCSLPGEPGNGPDQQLQRSPPEFQ                                                71 - 97
//

Text Mined References (8)

PMID Year Title
25306109 2014 Cross-talking noncoding RNAs contribute to cell-specific neurodegeneration in SCA7.
23475819 2013 Deletion of chromosome 12q21 affecting KCNC2 and ATXN7L3B in a family with neurodevelopmental delay and ataxia.
16680195 2006 Genome-wide survey for biologically functional pseudogenes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.