Property Summary

NCBI Gene PubMed Count 22
Grant Count 43
R01 Count 35
Funding $5,064,959.97
PubMed Score 94.34
PubTator Score 22.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 3.100 0.003
ependymoma 2.200 0.034
oligodendroglioma 3.400 0.001
cutaneous lupus erythematosus -1.100 0.001
psoriasis 1.300 0.000
glioblastoma 1.600 0.005
osteosarcoma 1.490 0.000
group 3 medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.400 0.000
adult high grade glioma 1.600 0.000
pilocytic astrocytoma 1.900 0.000
subependymal giant cell astrocytoma -1.873 0.013
ovarian cancer -1.100 0.000

Gene RIF (8)

PMID Text
22930747 Data indicate that median methylation levels of BCAN, HOXD1, KCTD8, KLF11, NXPH1, POU4F1, SIM1, and TCF7L1 were >/=30% higher than in normal samples, representing potential biomarkers for tumor diagnosis.
21997179 High Brevican is associated with the invasive phenotype of low-grade astrocytoma.
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19910543 Observational study of gene-disease association. (HuGE Navigator)
18611854 The proteoglycan brevican binds to fibronectin after proteolytic cleavage and promotes glioma cell motility
16133547 These results demonstrate for the first time that ADAMTS-5 is capable of degrading brevican and is overexpressed in glioblastoma cells, and suggest that ADAMTS-5 may play a role in glioma cell invasion through the cleavage of brevican.
16061654 Authors describe the expression of BEHAB/brevican in human brain and characterize two novel glioma-specific isoforms which are generated by differential glycosylation and are absent from normal adult brain and other neuropathologies.
11873941 gene locus at chromosome 1q21-23.

AA Sequence

MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRA      1 - 70
VLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQ     71 - 140
HGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSD    141 - 210
QTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQER    211 - 280
GAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNV    281 - 350
YCFRDSAQPSAIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIMEDGGGGSST    351 - 420
PEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALWAWPSELSSPG    421 - 490
PEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTETLPTPRERNLASPSPSTLV    491 - 560
EAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRAPEGTRELEAPSEDNSGRTAPAGTSVQAQPV    561 - 630
LPTDSASRGGVAVVPASGDCVPSPCHNGGTCLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACY    631 - 700
KHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWN    701 - 770
PGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVL    771 - 840
RYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKALLIPPSSPMPG    841 - 910
P//

Text Mined References (24)

PMID Year Title
22930747 2012 Genome-wide methylation screen in low-grade breast cancer identifies novel epigenetically altered genes as potential biomarkers for tumor diagnosis.
21997179 2012 Brevican, neurocan, tenascin-C and versican are mainly responsible for the invasiveness of low-grade astrocytoma.
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
19910543 2010 Confirmation of genomewide association signals in Chinese Han population reveals risk loci for ischemic stroke.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
18611854 2008 The proteoglycan brevican binds to fibronectin after proteolytic cleavage and promotes glioma cell motility.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16133547 2005 Human glioblastomas overexpress ADAMTS-5 that degrades brevican.
More...