Property Summary

NCBI Gene PubMed Count 22
PubMed Score 102.01
PubTator Score 22.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.600 2.3e-04
astrocytic glioma 3.100 3.2e-03
Astrocytoma, Pilocytic 1.900 9.4e-07
atypical teratoid / rhabdoid tumor -1.600 2.1e-03
cutaneous lupus erythematosus -1.100 9.2e-04
ependymoma 2.200 3.4e-02
glioblastoma 1.600 4.7e-03
group 3 medulloblastoma -2.000 4.4e-05
medulloblastoma, large-cell -1.900 2.2e-06
oligodendroglioma 3.400 1.0e-03
osteosarcoma 1.490 1.1e-06
ovarian cancer -1.100 2.3e-06
psoriasis 1.300 1.9e-04
subependymal giant cell astrocytoma -1.750 3.9e-03

 MGI Phenotype (1)

 CSPA Cell Line (2)

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRA      1 - 70
VLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQ     71 - 140
HGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSD    141 - 210
QTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQER    211 - 280
GAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNV    281 - 350
YCFRDSAQPSAIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIMEDGGGGSST    351 - 420
PEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALWAWPSELSSPG    421 - 490
PEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPTETLPTPRERNLASPSPSTLV    491 - 560
EAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRAPEGTRELEAPSEDNSGRTAPAGTSVQAQPV    561 - 630
LPTDSASRGGVAVVPASGDCVPSPCHNGGTCLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACY    631 - 700
KHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWN    701 - 770
PGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVL    771 - 840
RYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKALLIPPSSPMPG    841 - 910
P//

Text Mined References (24)

PMID Year Title