Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.61
PubTator Score 4.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.32996786263857E-14
psoriasis 6685 1.30205306332636E-9
pilocytic astrocytoma 3086 6.3429306802525E-7
pituitary cancer 1972 3.26878743201298E-6
group 4 medulloblastoma 1875 1.14287920968076E-5
cystic fibrosis 1670 2.78514857692766E-5
pediatric high grade glioma 2712 2.05223727140288E-4
glioblastoma 5572 3.26546604938671E-4
osteosarcoma 7933 6.89917315520108E-4
adrenocortical carcinoma 1427 0.00122766884350624
lung cancer 4473 0.00134814501290723
ulcerative colitis 2087 0.00223618156563875
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00985293108689576
subependymal giant cell astrocytoma 2287 0.0137495027796711
astrocytoma 1493 0.0141673323375033
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0247895651314187
Breast cancer 3099 0.024960896871749
colon cancer 1475 0.0486910644119604
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 3.079 1.5

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma -1.400 0.014
psoriasis -1.100 0.000
glioblastoma -1.700 0.000
oligodendroglioma -1.100 0.000
osteosarcoma -2.080 0.001
group 4 medulloblastoma -1.900 0.000
cystic fibrosis 1.482 0.000
adrenocortical carcinoma 1.251 0.001
intraductal papillary-mucinous carcinoma... 1.100 0.025
intraductal papillary-mucinous neoplasm ... 1.500 0.010
colon cancer -1.500 0.049
lung cancer 1.400 0.001
Breast cancer 3.400 0.025
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -2.032 0.014
ulcerative colitis -1.100 0.002
pituitary cancer 1.600 0.000

Synonym

Accession Q96GV9
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (2)

PMID Text
26316022 C5orf30 is a previously unidentified negative regulator of tissue damage in rheumatoid arthritis, and this protein may act by modulating the autoaggressive phenotype that is characteristic of synovial fibroblasts
23817893 The variant rs26232, in the first intron of the C5orf30 locus, is associated with the severity of radiologic damage in rheumatoid arthritis and is independent of established prognostic biomarkers.

AA Sequence

MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEEL      1 - 70
LKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKS     71 - 140
LPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT        141 - 206
//

Text Mined References (17)

PMID Year Title
26439407 2015 Rheumatoid arthritis: C5orf30 regulates severity of tissue destruction in RA.
26316022 2015 C5orf30 is a negative regulator of tissue damage in rheumatoid arthritis.
25416956 2014 A proteome-scale map of the human interactome network.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23817893 2013 Allele-dose association of the C5orf30 rs26232 variant with joint damage in rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22085962 2011 An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
More...