Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.61
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma -1.400 0.014
psoriasis -1.100 0.000
glioblastoma -1.700 0.000
oligodendroglioma -1.100 0.000
osteosarcoma -2.080 0.001
group 4 medulloblastoma -1.900 0.000
cystic fibrosis 1.482 0.000
adrenocortical carcinoma 1.251 0.001
intraductal papillary-mucinous carcinoma... 1.100 0.025
intraductal papillary-mucinous neoplasm ... 1.500 0.010
colon cancer -1.500 0.049
lung cancer 1.400 0.001
Breast cancer 3.400 0.025
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -2.032 0.014
ulcerative colitis -1.100 0.002
pituitary cancer 1.600 0.000

Gene RIF (2)

PMID Text
26316022 C5orf30 is a previously unidentified negative regulator of tissue damage in rheumatoid arthritis, and this protein may act by modulating the autoaggressive phenotype that is characteristic of synovial fibroblasts
23817893 The variant rs26232, in the first intron of the C5orf30 locus, is associated with the severity of radiologic damage in rheumatoid arthritis and is independent of established prognostic biomarkers.

AA Sequence

MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEEL      1 - 70
LKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKS     71 - 140
LPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT        141 - 206
//

Text Mined References (17)

PMID Year Title
26439407 2015 Rheumatoid arthritis: C5orf30 regulates severity of tissue destruction in RA.
26316022 2015 C5orf30 is a negative regulator of tissue damage in rheumatoid arthritis.
25416956 2014 A proteome-scale map of the human interactome network.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23817893 2013 Allele-dose association of the C5orf30 rs26232 variant with joint damage in rheumatoid arthritis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22085962 2011 An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
More...