Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.61
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.251 1.2e-03
adult high grade glioma -1.300 2.4e-03
astrocytic glioma -1.200 3.6e-02
Astrocytoma, Pilocytic -1.400 5.2e-07
Breast cancer 3.400 2.5e-02
colon cancer -1.500 4.9e-02
cystic fibrosis 1.482 2.8e-05
glioblastoma -1.400 1.8e-02
group 4 medulloblastoma -1.900 1.1e-05
intraductal papillary-mucinous carcinoma... 1.100 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.500 9.9e-03
lung cancer 1.300 3.8e-02
oligodendroglioma -1.100 1.3e-14
osteosarcoma -2.080 6.9e-04
pituitary cancer 1.600 3.3e-06
psoriasis -1.100 1.3e-09
subependymal giant cell astrocytoma -2.032 1.4e-02
ulcerative colitis -1.100 2.2e-03

Gene RIF (2)

AA Sequence

MEVDINGESRSTLTTLPFPGAEANSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEEL      1 - 70
LKLAQKCTGGEESKAEAMPSLRSKQLDAGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKS     71 - 140
LPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNLDKMIKEPADTEVLQYQLQHLTLRGDRVFARNNT        141 - 206
//

Text Mined References (17)

PMID Year Title