Property Summary

NCBI Gene PubMed Count 9
Grant Count 103
R01 Count 71
Funding $6,977,372.65
PubMed Score 40.26
PubTator Score 14.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
pterygium 74 3.501 1.8

Synonym

Accession Q96GU1 Q2NL97 Q5JUL0 Q8WWL9 PAGE-5
Symbols CT16
CT16.1
CT16.2
GAGEE1
PAGE-5

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
23028975 Results indicate that CT16 promotes the survival of melanoma cells and is therefore a potential target for future drug development.

AA Sequence

MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAP      1 - 70
SGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL               71 - 130
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028975 2012 Melanoma-associated cancer-testis antigen 16 (CT16) regulates the expression of apoptotic and antiapoptotic genes and promotes cell survival.
22073178 2011 Characterization of intrinsically disordered prostate associated gene (PAGE5) at single residue resolution by NMR spectroscopy.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20658534 2011 Detection of melanoma-derived cancer-testis antigen CT16 in patient sera by a novel immunoassay.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11992404 2002 The XAGE family of cancer/testis-associated genes: alignment and expression profile in normal tissues, melanoma lesions and Ewing's sarcoma.
11920606 2002 Identification of cancer/testis genes by database mining and mRNA expression analysis.