Property Summary

NCBI Gene PubMed Count 9
PubMed Score 41.35
PubTator Score 14.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Delusional disorder 13 3.716 1.9
pterygium 76 3.461 1.7

Expression

Gene RIF (1)

AA Sequence

MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAP      1 - 70
SGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL               71 - 130
//

Text Mined References (10)

PMID Year Title