Property Summary

NCBI Gene PubMed Count 9
PubMed Score 12.09
PubTator Score 2.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 1.5e-04
Disease Target Count Z-score Confidence
Hydrocele 8 3.565 1.8

AA Sequence

MSWRGRSTYRPRPRRSLQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADL      1 - 70
QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV                                  71 - 111
//

Text Mined References (9)

PMID Year Title