Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.24
PubTator Score 2.38

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.49695894295703E-4
Disease Target Count Z-score Confidence
Hydrocele 8 3.538 1.8

AA Sequence

QELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV                                  71 - 111

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11992404 2002 The XAGE family of cancer/testis-associated genes: alignment and expression profile in normal tissues, melanoma lesions and Ewing's sarcoma.
11181995 2001 The sequence of the human genome.
10197611 1999 Novel genes in the PAGE and GAGE family of tumor antigens found by homology walking in the dbEST database.