Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.76
PubTator Score 0.27

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96GS6 A8K0G8 D6W5Z9 Q6PJU2 Q8WUH9 Q9BWL0 Q9H7Q9
Symbols C19orf27
FAM108A1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHL      1 - 70
TERADFQYSQRELDTIEVFPTKSARGNRVSCMYVRCVPGARYTVLFSHGNAVDLGQMSSFYIGLGSRLHC     71 - 140
NIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVL    141 - 210
HSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVE    211 - 280
GAGHNDIELYSQYLERLRRFISQELPSQRA                                            281 - 310
//

Text Mined References (10)

PMID Year Title