Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.22
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96GS4 Q53HS4 Q9NXW8
Symbols PRO2472
C17orf59

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MESSRGRPGPETDLLAVAEHQALVFGGGPGRTSSEPPAGLRVSGEEETENVGGANRHPRTSPKTSSCGVV      1 - 70
HRPEREALENEPGPQGTLSGAGSRRGAPGAEHEPSLSSRHKNPAPPEGKPSSGRDCRRGGPGGGMDVEQQ     71 - 140
EEEDNDEEAAAGSRAGRSFSSRLQDSRSLDGLSEACGGAGSSGSAESGAGGGRRATISSPLELEGTVSRH    141 - 210
GDLTHFVANNLQLKIRLSGAPPPPPSAPARPCPAPAPTPTPAIPPIDPEVLRDLERLSRELGGRVDRLLR    211 - 280
GLGGAVQELTALSVGCIQTYRDAVDSLGEAVDMSIKGMYTLLARCEELERALQPVQGLARQVRDIRRTLE    281 - 350
VLEALCK                                                                   351 - 357
//

Text Mined References (13)

PMID Year Title