Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.21
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Neuronal ceroid lipofuscinosis 28 3.277 1.6

Expression

Synonym

Accession Q96GR4 A6NH95 B2RE03 Q5T265 Q5T267 Q5T268 Q86VT5 Q96T09
Symbols ZNF400
DHHC-12

Gene

AA Sequence

MAPWALLSPGVLVRTGHTVLTWGITLVLFLHDTELRQWEEQGELLLPLTFLLLVLGSLLLYLAVSLMDPG      1 - 70
YVNVQPQPQEELKEEQTAMVPPAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHP     71 - 140
LFVVYLALQLVVLLWGLYLAWSGLRFFQPWGQWLRSSGLLFATFLLLSLFSLVASLLLVSHLYLVASNTT    141 - 210
TWEFISSHRIAYLRQRPSNPFDRGLTRNLAHFFCGWPSGSWETLWAEEEEEGSSPAV                 211 - 267
//

Text Mined References (10)

PMID Year Title
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23568457 2013 Genetic variants associated with disordered eating.
23034182 2012 Analysis of substrate specificity of human DHHC protein acyltransferases using a yeast expression system.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16647879 2006 Intracellular localization and tissue-specific distribution of human and yeast DHHC cysteine-rich domain-containing proteins.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.