Property Summary

NCBI Gene PubMed Count 15
PubMed Score 218.26
PubTator Score 150.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma -1.978 5.7e-05
adult high grade glioma -1.800 1.9e-03
Astrocytoma, Pilocytic -1.500 6.9e-05
Atopic dermatitis -1.600 4.9e-02
atypical teratoid / rhabdoid tumor -3.600 2.7e-05
chronic rhinosinusitis -1.088 4.1e-02
Down syndrome 1.100 1.4e-02
ependymoma -2.900 2.5e-09
glioblastoma -1.800 7.6e-04
group 3 medulloblastoma -3.300 2.7e-06
medulloblastoma, large-cell -4.100 4.2e-07
nasopharyngeal carcinoma -1.100 2.5e-06
osteosarcoma -2.521 2.1e-05
pancreatic cancer 1.500 1.2e-03
pancreatic carcinoma 1.500 1.2e-03
primitive neuroectodermal tumor -2.700 1.8e-03
psoriasis -2.700 2.7e-04

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELSVPEKVN      1 - 70
NAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYL     71 - 140
LARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMV    141 - 210
DTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV    211 - 280
YTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCF    281 - 350
AEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL    351 - 420
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYN    421 - 490
YRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFL    491 - 560
YITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTE    561 - 630
QAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTM    631 - 700
KLKRLTVLEKYKGIIDSFYQEQKM                                                  701 - 724
//

Text Mined References (18)

PMID Year Title