Property Summary

NCBI Gene PubMed Count 15
Grant Count 24
R01 Count 17
Funding $2,154,918.17
PubMed Score 206.28
PubTator Score 150.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
pancreatic cancer 1.500 0.001
psoriasis -2.800 0.000
osteosarcoma -2.521 0.000
ependymoma -2.900 0.000
glioblastoma -2.100 0.000
sonic hedgehog group medulloblastoma -4.400 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
medulloblastoma, large-cell -4.100 0.000
primitive neuroectodermal tumor -2.700 0.002
Atopic dermatitis -1.600 0.049
adrenocortical carcinoma -1.978 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -1.600 0.000
pancreatic carcinoma 1.500 0.001
nasopharyngeal carcinoma -1.100 0.000
Down syndrome 1.100 0.014
chronic rhinosinusitis -1.088 0.041

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
15800013 expression tends to be correlated with the severity of X-linked adrenoleukodystrophy

AA Sequence

MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELSVPEKVN      1 - 70
NAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLIALGFKRQDKWEHISYSQYYL     71 - 140
LARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMV    141 - 210
DTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV    211 - 280
YTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCF    281 - 350
AEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL    351 - 420
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYN    421 - 490
YRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFL    491 - 560
YITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTE    561 - 630
QAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTM    631 - 700
KLKRLTVLEKYKGIIDSFYQEQKM                                                  701 - 724
//

Text Mined References (18)

PMID Year Title
20691247 2010 A genome-wide association study of Cloninger's temperament scales: implications for the evolutionary genetics of personality.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16371355 2006 The second member of the human and murine bubblegum family is a testis- and brainstem-specific acyl-CoA synthetase.
15800013 2005 Decreased expression of ABCD4 and BG1 genes early in the pathogenesis of X-linked adrenoleukodystrophy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15464426 X-linked adrenoleukodystrophy: role of very long-chain acyl-CoA synthetases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14516277 2004 Murine bubblegum orthologue is a microsomal very long-chain acyl-CoA synthetase.
More...