Property Summary

NCBI Gene PubMed Count 7
PubMed Score 27.75
PubTator Score 8.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.600 2.7e-04
atypical teratoid / rhabdoid tumor -1.400 1.1e-05
glioblastoma 1.100 6.7e-04
medulloblastoma -1.100 1.7e-03
medulloblastoma, large-cell 1.100 1.0e-02
Multiple Sclerosis 1.400 4.9e-03
osteosarcoma 2.660 1.4e-03
primitive neuroectodermal tumor 1.200 4.4e-03

Gene RIF (3)

AA Sequence

MEGAGPRGAGPARRRGAGGPPSPLLPSLLLLLLLWMLPDTVAPQELNPRGRNVCRAPGSQVPTCCAGWRQ      1 - 70
QGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPDCKELCSCHPHGQCEDVTGQ     71 - 140
CTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWWGAQCASACYCSATSRCDPQTGACLCHAGWWGRS    141 - 210
CNNQCACNSSPCEQQSGRCQCRERTFGARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGL    211 - 280
GCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRC    281 - 350
NAGWIGDRCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQACS    351 - 420
CHEDTCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPTRRPRPRRELSLGRKKAP    421 - 490
HRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDE    491 - 560
GPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTTPASAEEAIPLPASSDSERSASSVEGPGGALYAR    561 - 630
VARREARPARARGEIGGLSLSPSPERRKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSEAAPSPS    631 - 700
KRKRTPSDKSAHTVEHGSPRTRDPTPRPPGLPEEATALAAPSPPRARARAAPRPLGAHGRRRSPAKRAEA    701 - 770
ASMLAADVRGKTRSLGRAEVALGAQGPREKPAPPQKAKRSVPPASPARAPPATETPGPEKAATDLPAPET    771 - 840
PRKKTPIQKPPRKKSREAAGELGRAGAPTL                                            841 - 870
//

Text Mined References (13)

PMID Year Title