Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 4
Funding $237,362.19
PubMed Score 25.96
PubTator Score 8.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 2.660 0.001
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.100 0.002
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor 1.200 0.004
Multiple Sclerosis 1.400 0.005
adult high grade glioma -1.600 0.000

Synonym

Accession Q96GP6 E5RFB8 Q58A83 Q8IXF3 Q9BW74
Symbols NSR1
SREC2
VDEGS
SREC-II
SRECRP-1

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
24478002 the full VDEGS phenotype may include sclerocornea resulting from homozygosity or compound heterozygosity for loss of function variants in SCARF2.
20887961 Mutations in SCARF2 are responsible for Van Den Ende-Gupta syndrome.
12154095 SRECII binds to SRECI and has a similar tissue distribution pattern

AA Sequence

MEGAGPRGAGPARRRGAGGPPSPLLPSLLLLLLLWMLPDTVAPQELNPRGRNVCRAPGSQVPTCCAGWRQ      1 - 70
QGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTKCPRQFWGPDCKELCSCHPHGQCEDVTGQ     71 - 140
CTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWWGAQCASACYCSATSRCDPQTGACLCHAGWWGRS    141 - 210
CNNQCACNSSPCEQQSGRCQCRERTFGARCDRYCQCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGL    211 - 280
GCRRRCGQCKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRC    281 - 350
NAGWIGDRCETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQACS    351 - 420
CHEDTCDPVTGACHLETNQRKGVMGAGALLVLLVCLLLSLLGCCCACRGKDPTRRPRPRRELSLGRKKAP    421 - 490
HRLCGRFSRISMKLPRIPLRRQKLPKVVVAHHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDE    491 - 560
GPVYCVPHEEAPAESRDPEVPTVPAEAPAPSPVPLTTPASAEEAIPLPASSDSERSASSVEGPGGALYAR    561 - 630
VARREARPARARGEIGGLSLSPSPERRKPPPPDPATKPKVSWIHGKHSAAAAGRAPSPPPPGSEAAPSPS    631 - 700
KRKRTPSDKSAHTVEHGSPRTRDPTPRPPGLPEEATALAAPSPPRARARAAPRPLGAHGRRRSPAKRAEA    701 - 770
ASMLAADVRGKTRSLGRAEVALGAQGPREKPAPPQKAKRSVPPASPARAPPATETPGPEKAATDLPAPET    771 - 840
PRKKTPIQKPPRKKSREAAGELGRAGAPTL                                            841 - 870
//

Text Mined References (13)

PMID Year Title
24478002 2014 Sclerocornea in a patient with van den Ende-Gupta syndrome homozygous for a SCARF2 microdeletion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20887961 2010 Mutations in SCARF2 are responsible for Van Den Ende-Gupta syndrome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...