| Tbio | Cell division cycle-associated 7-like protein |
Plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter. Plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. Involved in apoptotic signaling pathways; May act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.
Comments
Property Summary
| NCBI Gene PubMed Count | 25 |
| Grant Count | 6 |
| Funding | $285,312.92 |
| PubMed Score | 10.51 |
| PubTator Score | 20.15 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytoma | 1.400 | 0.000 |
| glioblastoma multiforme | 2.500 | 0.000 |
| oligodendroglioma | 1.800 | 0.000 |
| osteosarcoma | -2.971 | 0.001 |
| ependymoma | 1.200 | 0.001 |
| sonic hedgehog group medulloblastoma | 2.200 | 0.000 |
| atypical teratoid / rhabdoid tumor | 1.800 | 0.002 |
| medulloblastoma, large-cell | 2.400 | 0.000 |
| primitive neuroectodermal tumor | 1.400 | 0.001 |
| adrenocortical carcinoma | 1.303 | 0.006 |
| primary pancreatic ductal adenocarcinoma | -1.199 | 0.008 |
| tuberculosis and treatment for 3 months | 1.300 | 0.001 |
| adult high grade glioma | 2.500 | 0.000 |
| pilocytic astrocytoma | 2.100 | 0.000 |
| Breast cancer | -1.500 | 0.000 |
| lung carcinoma | -2.200 | 0.000 |
| ovarian cancer | -1.700 | 0.000 |
| pancreatic cancer | -1.100 | 0.017 |
| PMID | Text |
|---|---|
| 26245978 | common LEDGF/p75 interaction interface shared by JPO2, PogZ, MLL1, IWS1 and HIV IN |
| 26245978 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
| 26245978 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
| 26245978 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
| 25480495 | The data are consistent with the rs4487645-CDCA7L loci being responsible for the chromosome 7p11.2 association with multiple myeloma risk, probably exerting its effects through an extended pathway involving IRF4 and MYC. |
| 24634210 | Data indicate that JPO2 and LEDGF/p75 interact directly and specifically in vivo through the specific interaction domain of JPO2 and the C-terminal domain of LEDGF/p75. |
| 24634210 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
| 24141559 | CDCA7L was able to activate the extracellular signal-regulated kinase 1/2 (ERK1/2) signaling pathway and regulate the cell cycle, thus promoting HCC progression. |
| 23898208 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
| 21654740 | Reduction in R1 repressor protein correlates significantly with an increase (approximately 40%) in monoamine oxidase A protein levels within the major depressive disorder groups compared with controls. |
| More... |
MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDVRFHSKYFTEELR 1 - 70 RIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSI 71 - 140 GLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESEDDSRDESQES 141 - 210 SDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSASRKKTVRRAFSEGQITRRMNPTRSARPPEK 211 - 280 FALENFTVSAAKFAEEFYSFRRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLG 281 - 350 NTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPDWVCPPCRGICNCSYCRKRDG 351 - 420 RCATGILIHLAKFYGYDNVKEYLESLQKELVEDN 421 - 454 //
| PMID | Year | Title |
|---|---|---|
| 26245978 | 2015 | Multiple cellular proteins interact with LEDGF/p75 through a conserved unstructured consensus motif. |
| 25480495 | 2015 | The 7p15.3 (rs4487645) association for multiple myeloma shows strong allele-specific regulation of the MYC-interacting gene CDCA7L in malignant plasma cells. |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. |
| 24705354 | 2014 | The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease. |
| 24634210 | 2014 | Dynamics of the ternary complex formed by c-Myc interactor JPO2, transcriptional co-activator LEDGF/p75, and chromatin. |
| 24141559 | 2013 | CDCA7L promotes hepatocellular carcinoma progression by regulating the cell cycle. |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
| 21654740 | 2011 | The reduction of R1, a novel repressor protein for monoamine oxidase A, in major depressive disorder. |
| 21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
| 20189936 | 2010 | A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci. |
| More... |
