Property Summary

NCBI Gene PubMed Count 25
PubMed Score 10.51
PubTator Score 20.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.89906180388374E-26
glioblastoma multiforme 347 1.15181178496976E-21
oligodendroglioma 2849 2.94564594267379E-10
astrocytoma 1493 2.81462375313486E-8
pilocytic astrocytoma 3086 1.6370225789535E-7
sonic hedgehog group medulloblastoma 1482 1.86200233211953E-7
ovarian cancer 8492 7.1453771090563E-6
adult high grade glioma 2148 1.27417849909273E-5
medulloblastoma, large-cell 6234 1.60981730083508E-5
Breast cancer 3099 1.41970270770885E-4
tuberculosis and treatment for 3 months 327 5.82179266111945E-4
osteosarcoma 7933 6.44160272881759E-4
ependymoma 2514 8.06768194806064E-4
primitive neuroectodermal tumor 3031 8.63257068055251E-4
atypical teratoid / rhabdoid tumor 4369 0.00214506499517121
adrenocortical carcinoma 1427 0.00573832979734393
primary pancreatic ductal adenocarcinoma 1271 0.00834446534584673
pancreatic cancer 2300 0.0171282111200851
Disease Target Count
Ciliary dyskinesia, primary, 7 2

Expression

  Differential Expression (18)

Synonym

Gene

  Ortholog (11)

Gene RIF (13)

PMID Text
26245978 common LEDGF/p75 interaction interface shared by JPO2, PogZ, MLL1, IWS1 and HIV IN
26245978 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
25480495 The data are consistent with the rs4487645-CDCA7L loci being responsible for the chromosome 7p11.2 association with multiple myeloma risk, probably exerting its effects through an extended pathway involving IRF4 and MYC.
24634210 Data indicate that JPO2 and LEDGF/p75 interact directly and specifically in vivo through the specific interaction domain of JPO2 and the C-terminal domain of LEDGF/p75.
24634210 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
24141559 CDCA7L was able to activate the extracellular signal-regulated kinase 1/2 (ERK1/2) signaling pathway and regulate the cell cycle, thus promoting HCC progression.
23898208 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
21654740 Reduction in R1 repressor protein correlates significantly with an increase (approximately 40%) in monoamine oxidase A protein levels within the major depressive disorder groups compared with controls.
18789977 Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells
17669426 Over-expression of JPO2 resulted in a modest but reproducible inhibition of HIV-1 replication, consistent with competition between integrase and JPO2 for binding to LEDGF/p75
More...

AA Sequence

MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDVRFHSKYFTEELR      1 - 70
RIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSI     71 - 140
GLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESEDDSRDESQES    141 - 210
SDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSASRKKTVRRAFSEGQITRRMNPTRSARPPEK    211 - 280
FALENFTVSAAKFAEEFYSFRRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLG    281 - 350
NTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPDWVCPPCRGICNCSYCRKRDG    351 - 420
RCATGILIHLAKFYGYDNVKEYLESLQKELVEDN                                        421 - 454
//

Text Mined References (32)

PMID Year Title
26245978 2015 Multiple cellular proteins interact with LEDGF/p75 through a conserved unstructured consensus motif.
25480495 2015 The 7p15.3 (rs4487645) association for multiple myeloma shows strong allele-specific regulation of the MYC-interacting gene CDCA7L in malignant plasma cells.
25416956 2014 A proteome-scale map of the human interactome network.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24634210 2014 Dynamics of the ternary complex formed by c-Myc interactor JPO2, transcriptional co-activator LEDGF/p75, and chromatin.
24141559 2013 CDCA7L promotes hepatocellular carcinoma progression by regulating the cell cycle.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21654740 2011 The reduction of R1, a novel repressor protein for monoamine oxidase A, in major depressive disorder.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
More...