Property Summary

NCBI Gene PubMed Count 27
PubMed Score 11.22
PubTator Score 20.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.303 5.7e-03
adult high grade glioma 2.500 1.3e-05
astrocytoma 1.400 2.8e-08
Astrocytoma, Pilocytic 2.100 1.0e-07
atypical teratoid / rhabdoid tumor 1.800 2.1e-03
Breast cancer -1.500 1.4e-04
ependymoma 1.200 8.1e-04
glioblastoma 2.500 1.7e-11
group 3 medulloblastoma 1.700 7.9e-05
lung carcinoma -2.200 1.9e-26
medulloblastoma, large-cell 2.400 1.6e-05
oligodendroglioma 1.800 2.9e-10
osteosarcoma -2.971 6.4e-04
ovarian cancer -1.700 7.1e-06
pancreatic cancer -1.100 1.7e-02
primary pancreatic ductal adenocarcinoma -1.199 8.3e-03
primitive neuroectodermal tumor 1.400 8.6e-04
tuberculosis 1.100 5.9e-05

Gene RIF (14)

AA Sequence

MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDVRFHSKYFTEELR      1 - 70
RIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSI     71 - 140
GLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESEDDSRDESQES    141 - 210
SDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSASRKKTVRRAFSEGQITRRMNPTRSARPPEK    211 - 280
FALENFTVSAAKFAEEFYSFRRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLG    281 - 350
NTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPDWVCPPCRGICNCSYCRKRDG    351 - 420
RCATGILIHLAKFYGYDNVKEYLESLQKELVEDN                                        421 - 454
//

Text Mined References (35)

PMID Year Title