Tbio | Cell division cycle-associated 7-like protein |
Plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter. Plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. Involved in apoptotic signaling pathways; May act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.
Comments
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2844 | 1.89906180388374E-26 |
glioblastoma multiforme | 347 | 1.15181178496976E-21 |
oligodendroglioma | 2849 | 2.94564594267379E-10 |
astrocytoma | 1493 | 2.81462375313486E-8 |
pilocytic astrocytoma | 3086 | 1.6370225789535E-7 |
sonic hedgehog group medulloblastoma | 1482 | 1.86200233211953E-7 |
ovarian cancer | 8492 | 7.1453771090563E-6 |
adult high grade glioma | 2148 | 1.27417849909273E-5 |
medulloblastoma, large-cell | 6234 | 1.60981730083508E-5 |
Breast cancer | 3099 | 1.41970270770885E-4 |
tuberculosis and treatment for 3 months | 327 | 5.82179266111945E-4 |
osteosarcoma | 7933 | 6.44160272881759E-4 |
ependymoma | 2514 | 8.06768194806064E-4 |
primitive neuroectodermal tumor | 3031 | 8.63257068055251E-4 |
atypical teratoid / rhabdoid tumor | 4369 | 0.00214506499517121 |
adrenocortical carcinoma | 1427 | 0.00573832979734393 |
primary pancreatic ductal adenocarcinoma | 1271 | 0.00834446534584673 |
pancreatic cancer | 2300 | 0.0171282111200851 |
Disease | Target Count |
---|---|
Ciliary dyskinesia, primary, 7 | 2 |
Disease | log2 FC | p |
---|---|---|
astrocytoma | 1.400 | 0.000 |
glioblastoma multiforme | 2.500 | 0.000 |
oligodendroglioma | 1.800 | 0.000 |
osteosarcoma | -2.971 | 0.001 |
ependymoma | 1.200 | 0.001 |
sonic hedgehog group medulloblastoma | 2.200 | 0.000 |
atypical teratoid / rhabdoid tumor | 1.800 | 0.002 |
medulloblastoma, large-cell | 2.400 | 0.000 |
primitive neuroectodermal tumor | 1.400 | 0.001 |
adrenocortical carcinoma | 1.303 | 0.006 |
primary pancreatic ductal adenocarcinoma | -1.199 | 0.008 |
tuberculosis and treatment for 3 months | 1.300 | 0.001 |
adult high grade glioma | 2.500 | 0.000 |
pilocytic astrocytoma | 2.100 | 0.000 |
Breast cancer | -1.500 | 0.000 |
lung carcinoma | -2.200 | 0.000 |
ovarian cancer | -1.700 | 0.000 |
pancreatic cancer | -1.100 | 0.017 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26245978 | common LEDGF/p75 interaction interface shared by JPO2, PogZ, MLL1, IWS1 and HIV IN |
26245978 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
25480495 | The data are consistent with the rs4487645-CDCA7L loci being responsible for the chromosome 7p11.2 association with multiple myeloma risk, probably exerting its effects through an extended pathway involving IRF4 and MYC. |
24634210 | Data indicate that JPO2 and LEDGF/p75 interact directly and specifically in vivo through the specific interaction domain of JPO2 and the C-terminal domain of LEDGF/p75. |
24634210 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
24141559 | CDCA7L was able to activate the extracellular signal-regulated kinase 1/2 (ERK1/2) signaling pathway and regulate the cell cycle, thus promoting HCC progression. |
23898208 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
21654740 | Reduction in R1 repressor protein correlates significantly with an increase (approximately 40%) in monoamine oxidase A protein levels within the major depressive disorder groups compared with controls. |
18789977 | Both HIV-1 IN and JPO2 proteins are present as oligomers and co-localize in the nucleus of HeLa cells |
17669426 | Over-expression of JPO2 resulted in a modest but reproducible inhibition of HIV-1 replication, consistent with competition between integrase and JPO2 for binding to LEDGF/p75 |
More... |
MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDVRFHSKYFTEELR 1 - 70 RIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSI 71 - 140 GLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESEDDSRDESQES 141 - 210 SDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSASRKKTVRRAFSEGQITRRMNPTRSARPPEK 211 - 280 FALENFTVSAAKFAEEFYSFRRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLG 281 - 350 NTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPDWVCPPCRGICNCSYCRKRDG 351 - 420 RCATGILIHLAKFYGYDNVKEYLESLQKELVEDN 421 - 454 //
PMID | Year | Title |
---|---|---|
26245978 | 2015 | Multiple cellular proteins interact with LEDGF/p75 through a conserved unstructured consensus motif. |
25480495 | 2015 | The 7p15.3 (rs4487645) association for multiple myeloma shows strong allele-specific regulation of the MYC-interacting gene CDCA7L in malignant plasma cells. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
24705354 | 2014 | The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease. |
24634210 | 2014 | Dynamics of the ternary complex formed by c-Myc interactor JPO2, transcriptional co-activator LEDGF/p75, and chromatin. |
24141559 | 2013 | CDCA7L promotes hepatocellular carcinoma progression by regulating the cell cycle. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
21654740 | 2011 | The reduction of R1, a novel repressor protein for monoamine oxidase A, in major depressive disorder. |
21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
20189936 | 2010 | A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci. |
More... |