Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.26
PubTator Score 11.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis -1.500 0.000
osteosarcoma -1.081 0.003
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 1.900 0.000
medulloblastoma 1.600 0.003
medulloblastoma, large-cell 2.600 0.000
primitive neuroectodermal tumor 1.200 0.005
lung cancer 1.600 0.000
pediatric high grade glioma 1.200 0.000

Synonym

Accession Q96GM5 A6NN27 Q92924 Q9Y635
Symbols Rsc6p
BAF60A
CRACD1

Gene

Gene RIF (5)

PMID Text
26542803 miR-7 expression reduced SMARCD1 protein expression in lung cancer cell lines.
25396734 the association of EGFR, CALM3 and SMARCD1 gene polymorphisms with bone mineral density in white women, as conducted.
19762545 SMARCD1/BAF60a is an androgen receptor cofactor that modulates TMPRSS2 expression
19454010 Most of the components of the SWI2/SNF2 chromatin remodeling complex (BRG1/BRM, BAF250, BAF180, BAF170, BAF155, BAF60a, BAF53A, actin and InI) except BRM, BAF155 and BAF57, are identified to interact with HIV-1 Tat in Jurkat cell
12917342 In addition to previously identified BAF250, BAF60a may provide another critical and direct link between nuclear receptors and the BRG1 complex that is required for promoter recruitment and subsequent chromatin remodeling

AA Sequence

MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMT      1 - 70
PQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIREL     71 - 140
VPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELR    141 - 210
VEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNV    211 - 280
RCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQ    281 - 350
RMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATL    351 - 420
DNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEA    421 - 490
VCRYFYSKVQQRRQELEQALGIRNT                                                 491 - 515
//

Text Mined References (34)

PMID Year Title
26542803 2016 MicroRNA-7 Compromises p53 Protein-dependent Apoptosis by Controlling the Expression of the Chromatin Remodeling Factor SMARCD1.
25416956 2014 A proteome-scale map of the human interactome network.
25396734 2014 Comprehensive analysis of the association of EGFR, CALM3 and SMARCD1 gene polymorphisms with BMD in Caucasian women.
24434208 2014 CARM1 methylates chromatin remodeling factor BAF155 to enhance tumor progression and metastasis.
24421395 2014 Residual complexes containing SMARCA2 (BRM) underlie the oncogenic drive of SMARCA4 (BRG1) mutation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19762545 2009 Functional screening of FxxLF-like peptide motifs identifies SMARCD1/BAF60a as an androgen receptor cofactor that modulates TMPRSS2 expression.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
18303029 2008 BAF60a interacts with p53 to recruit the SWI/SNF complex.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...