Property Summary

NCBI Gene PubMed Count 32
PubMed Score 17.49
PubTator Score 11.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 1.1e-07
glioblastoma 1.900 8.8e-07
group 4 medulloblastoma 1.600 7.4e-04
lung cancer 1.100 3.6e-03
malignant mesothelioma 1.400 1.5e-06
medulloblastoma, large-cell 2.600 4.6e-07
osteosarcoma -1.081 2.8e-03
pediatric high grade glioma 1.200 2.4e-04
primitive neuroectodermal tumor 1.200 4.7e-03
psoriasis -1.500 1.9e-04

 GWAS Trait (1)

Gene RIF (6)

AA Sequence

MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMT      1 - 70
PQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKKKKMADKILPQRIREL     71 - 140
VPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKRKLRIFISNTFNPAKSDAEDGEGTVASWELR    141 - 210
VEGRLLEDSALSKYDATKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNV    211 - 280
RCTVLLMLDYQPPQFKLDPRLARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQ    281 - 350
RMKFSEIPQRLHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATL    351 - 420
DNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAEFYFQPWAQEA    421 - 490
VCRYFYSKVQQRRQELEQALGIRNT                                                 491 - 515
//

Text Mined References (38)

PMID Year Title