Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.58
PubTator Score 0.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.500 3.4e-03
medulloblastoma, large-cell -1.600 1.2e-05
posterior fossa group B ependymoma -1.100 3.9e-10

AA Sequence

MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSTYAKPYPGPEAASRVP      1 - 70
PALVYALVTAGPTLTILLGELARAFFPAPPSAVPVIGESTIVSGACCRFSPPVRRLVRFLGVYSFGLFTT     71 - 140
TIFANAGQVVTGNPTPHFLSVCRPNYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDA    141 - 210
ALCAYAVTYTAMYVTLVFRVKGSRLVKPSLCLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFL    211 - 280
VTCVVHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT           281 - 343
//

Text Mined References (8)

PMID Year Title