Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.50
PubTator Score 3.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.010 0.000
posterior fossa group B ependymoma -1.900 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.500 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -1.400 0.004
primitive neuroectodermal tumor -1.200 0.004
adult high grade glioma -1.700 0.003
pilocytic astrocytoma -1.700 0.000
lung carcinoma 1.500 0.000
pituitary cancer -2.900 0.000
psoriasis -1.900 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19671756 NDSP is specifically overexpressed in neuroblastoma and actively secreted from tumor cells. Furthermore, NDSP serves as a growth factor for neuroblastoma tumor cells through activation of the ERK-mediated proliferation pathway.

AA Sequence

MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKSGTEVADEEEEREHDLPTHPRGPTCNACSSQAL      1 - 70
DGRGSLAPLTSEPCSQPCGVAASHCTTCSPYSSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPSLKLA     71 - 140
APQSYPVTWPGSGREAFTNPRAISTDV                                               141 - 167
//

Text Mined References (8)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19671756 2009 Neuroblastoma-derived secretory protein is a novel secreted factor overexpressed in neuroblastoma.
17208556 2007 Neuroblastoma-derived secretory protein messenger RNA levels correlate with high-risk neuroblastoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.