Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung carcinoma 2,844

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 0.000

Synonym

Accession Q96GI7
Symbols C1orf153

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

AA Sequence

MSGARAAPGAAGNGAVRGLRVDGLPPLPKSLSGLLHSASGGGASGGWRHLERLYAQKSRIQDELSRGGPG      1 - 70
GGGARAAALPAKPPNLDAALALLRKEMVGLRQLDMSLLCQLYSLYESIQEYKGACQAASSPDCTYALENG     71 - 140
FFDEEEEYFQEQNSLHDRRDRGPPRDLSLPVSSLSSSDWILESI                              141 - 184
//

Text Mined References (6)

PMID Year Title
24954085 2014 Novel genetic variants modify the effect of smoking on carotid plaque burden in Hispanics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.