Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 3.0e-16

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.100 3.0e-16

Synonym

Accession Q96GI7
Symbols C1orf153

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSGARAAPGAAGNGAVRGLRVDGLPPLPKSLSGLLHSASGGGASGGWRHLERLYAQKSRIQDELSRGGPG      1 - 70
GGGARAAALPAKPPNLDAALALLRKEMVGLRQLDMSLLCQLYSLYESIQEYKGACQAASSPDCTYALENG     71 - 140
FFDEEEEYFQEQNSLHDRRDRGPPRDLSLPVSSLSSSDWILESI                              141 - 184
//

Text Mined References (6)

PMID Year Title