Property Summary

NCBI Gene PubMed Count 24
PubMed Score 26.05
PubTator Score 24.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy 1.183 3.3e-05
Breast cancer -2.900 4.8e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.4e-02
malignant mesothelioma 1.100 4.6e-06
medulloblastoma, large-cell -1.300 1.5e-05
non-small cell lung cancer 1.638 1.3e-13
osteosarcoma 1.902 5.8e-04
ovarian cancer 1.300 2.1e-03
pituitary cancer -1.300 1.9e-03
Rheumatoid arthritis 1.100 2.2e-02
sarcoidosis 1.200 4.1e-02
tuberculosis and treatment for 6 months 1.800 1.6e-04

Synonym

Accession Q96GG9 B2RB37 Q7L3G9 Q8TEX7 Q9H6M1 Q9HCT3
Symbols RP42
SCRO
Tes3
DCNL1
SCCRO
DCUN1L1

Gene

PDB

3TDU   3TDZ   4P5O   5UFI   5V83   5V86   5V88  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN      1 - 70
RYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQ     71 - 140
IPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK    141 - 210
DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV                         211 - 259
//

Text Mined References (27)

PMID Year Title