Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.99
PubTator Score 2.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.021 0.002
diabetes mellitus -1.100 0.003

Synonym

Accession Q96GF1 A8K5C1 A9X3T8 Q8N900
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
24727453 these results indicate that RNF185 negatively regulates osteogenesis through the degradation of Dvl2 and down-regulation of canonical Wnt signaling pathway and suggest a possible therapeutic target in osteoporosis.
24019521 data thus identify RNF185 and RNF5 as a novel E3 ligase module that is central to the control of CFTR degradation.
23898208 HIV-1 Tat downregulates the expression of ring finger protein 185 (RNF185) in human primary T cells
21931693 Human BNIP1 colocalizes with RNF185 at mitochondria and is polyubiquitinated by RNF185 through K63-based ubiquitin linkage in vivo.

AA Sequence

MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETR      1 - 70
PNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIG     71 - 140
AFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA                      141 - 192
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24727453 2014 The E3 ligase RNF185 negatively regulates osteogenic differentiation by targeting Dvl2 for degradation.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
21931693 2011 RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy through interaction with BNIP1.
19549727 2009 Analysis of the human E2 ubiquitin conjugating enzyme protein interaction network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...