Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.05
PubTator Score 1.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.100 0.007
active ulcerative colitis -1.457 0.006
non primary Sjogren syndrome sicca 1.100 0.044
invasive ductal carcinoma -1.500 0.000
ovarian cancer -1.400 0.000

Gene RIF (1)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVAR      1 - 70
KPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV                             71 - 116
//

Text Mined References (7)

PMID Year Title
21666724 2012 Identification and functional analysis of 9p24 amplified genes in human breast cancer.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.