Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.05
PubTator Score 1.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.457 6.4e-03
atypical teratoid / rhabdoid tumor -1.200 3.8e-04
glioblastoma -1.100 7.0e-03
invasive ductal carcinoma -1.500 8.3e-05
non primary Sjogren syndrome sicca 1.100 4.4e-02
ovarian cancer -1.400 4.2e-04

Gene RIF (1)

AA Sequence

MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVAR      1 - 70
KPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV                             71 - 116
//

Text Mined References (8)

PMID Year Title